HomeMy WebLinkAboutMAJESTIC ESTATES - PDP - PDP160016 - REPORTS - EROSION CONTROL LETTER/REPORTEROSION CONTROL REPORT
FOR
MAJESTIC ESTATES
Prepared For:
Suburban Land Reserve, Inc.
79 South Main Street, Suite 500
Salt Lake City, UT 84111
(801) 321- 7567
Prepared By:
JR ENGINEERING, LLC
2900 South College Avenue, Suite 3D
Fort Collins, CO 80525
(970)491-9888
Contact: Tim Halopoff, P.E.
July 2016
Job No. 39699.01
Erosion Control Report for Majestic Estates
Page i
EROSION CONTROL REPORT
MAJESTIC ESTATES
Project Name and Location: Majestic Estates
A parcel of land located in the Northwest Quarter of
Section 17, Township 6 North, Range 68 West of the
6th Principal Meridian in the City of Fort Collins,
Larimer County, Colorado.
Owners’ Name and Address: Suburban Land Reserve, Inc.
79 South Main Street, Suite 500
Salt Lake City, UT 84111
(801) 321- 7567
CERTIFICATION
I hereby affirm that this Erosion Control Report for the Majestic Estates project was prepared under my
direct supervision in accordance with the provisions of the Colorado Water Quality Control Act, and
the City of Fort Collins Standards and Specifications. JR Engineering does not and will not assume
liability for the implementation of the methods, requirements and standards set forth in this report.
_____________________________________________
Tim Halopoff, P.E.
For and On Behalf of JR Engineering
Contractor names and Addresses: Contractor to complete this section.
_____________________________________________________________________________
(Contractor’s Name)
_____________________________________________________________________________
(Contractor’s Address)
_____________________________________________________________________________
(Contact) (Position or Title)
Erosion Control Report for Majestic Estates
Page ii
EROSION CONTROL REPORT CERTIFICATION
“I certify under penalty of law that I have personally examined and am familiar with the
information submitted in this application and all attachments and that, based on my inquiry of
those individuals immediately responsible for obtaining the information, I believe that the
information is true, accurate and complete. I am aware that there are significant penalties for
submitting false information, including the possibility of fine or imprisonment.
“I understand the submittal of the application is for coverage under the state of Colorado
General Permit for Stormwater Discharges Associated with Construction Activity for the
entirety of the construction site/project described and applied for, until such time as the
application is amended or the certification is transferred, inactivated, or expired.”
"This Erosion Control Report fulfills the City of Fort Collins’ technical criteria to the best of my
knowledge. I understand that additional erosion and sediment control measures may be needed
if unforeseen erosion problems occur or if the submitted plan does not function as intended.
The requirements of this report shall run with the land and be the obligation of the land owner
or contractor until such time as the plan is properly completed, modified, inactivated or voided."
_____________________________________________________________________________
Signature of Legally Responsible Person Date Signed
_____________________________________________________________________________
Name (printed) Title
Erosion Control Report for Majestic Estates
Page iii
TABLE OF CONTENTS
1.0 Introduction .....................................................................................................................................................................................
1
2.0 Site Description ...............................................................................................................................................................................
2
2.1 Site Location ................................................................................................................................................................ 2
2.2 General Project Description .................................................................................................................................... 2
2.3 Existing Site Description ........................................................................................................................................... 2
2.4 Soil and Subsurface Conditions ............................................................................................................................... 2
2.5 Wetlands, Receiving Waters, and Endangered Species .................................................................................... 3
2.6 Description of Construction Activity .................................................................................................................... 3
2.7 Proposed Sequence of Major Activities ................................................................................................................ 3
2.8 Potential Pollutants ..................................................................................................................................................... 4
3.0 Controls .........................................................................................................................................................................................
5
3.1 Controls Overview .................................................................................................................................................... 5
3.2 Erosion and Sediment Controls .............................................................................................................................. 5
3.3 Structural Practices .................................................................................................................................................... 5
3.4 Non-Structural Practices .......................................................................................................................................... 8
3.5 Other Controls ......................................................................................................................................................... 10
3.6 Materials Management ............................................................................................................................................. 11
4.0 Spill Prevention and Contingency Plan .................................................................................................................................... 16
4.1 Purpose of the Spill Prevention Plan .................................................................................................................... 16
4.2 Hazards Assessment ................................................................................................................................................ 16
4.3 Emergency Response Procedures ........................................................................................................................ 19
4.4 Closing of the Spill Incident.................................................................................................................................... 22
5.0 Inspections and Maintenance .....................................................................................................................................................
23
5.1 Inspection and Maintenance Overview ............................................................................................................... 23
5.2 Inspection Reports ................................................................................................................................................... 24
5.3 Final Stabilization and Long-Term Stormwater Management ........................................................................ 26
6.0 Non-Stormwater Discharges ..................................................................................................................................................... 28
6.1 Management and Reporting of Hazardous Releases ........................................................................................ 28
6.2 Project Management ................................................................................................................................................ 28
7.0 Conclusion ......................................................................................................................................................................................
29
8.0. References ......................................................................................................................................................................................
31
Figure 1 – Vicinity Map
Appendix A – CDPS General Permit Forms
Appendix B – Inactivation/Reassignment/Transfer Forms
Appendix C – Erosion and Sediment Control Inspection Form
Appendix D – Spill Report Form
Appendix E – Reporting Chemical Spills in Colorado
Appendix F – NRCS Soil Data
Appendix G – Erosion Control Plan
Erosion Control Report for Majestic Estates
Page 1
INTRODUCTION
This report presents the erosion and sediment control of the construction plans for the Majestic
Estates project, located in the northwest quarter of Section 17, Township 6 North, Range 68 West
of the 6th Principal Meridian in the City of Fort Collins, Larimer County, Colorado. More
specifically, the Majestic Estates site is a 19.90 acre property that is currently undeveloped fallow
farmland previously planted with hay and is currently covered in native grasses and sparse alfalfa.
The site is zoned UE (Urban Estates) and will support single family estate lots once developed. The
proposed use of the site is 8 single family estate lots and about 13.5 acres of open space.
This report was prepared in compliance with the Colorado Water Quality Control Act, the Federal
Water Pollution Control Act, and City of Fort Collins and Urban Drainage and Flood Control
District standards.
This plan serves as a consolidated document for information on water quality protection for the
subject site and areas immediately adjacent. It should also be noted that this plan is a living
document that will need to be updated and maintained throughout the construction
process. The intent of this plan is to provide the contractor a tool to consolidate records, logs,
permits, applications, etc. as well as guidance on water quality protection. The plan incorporates
elements that can be found in the contract plans and specifications as well as the following:
x City of Fort Collins Storm Drainage Criteria Addendum to the Urban Storm Drainage Criteria
Manuals
x Colorado Department of Transportation Erosion Control and Stormwater Quality Guide
x Urban Drainage and Flood Control District Urban Storm Drainage Criteria Manual Volume 3 –
Best Management Practices
Erosion Control Report for Majestic Estates
Page 2
SITE DESCRIPTION
2.1 SITE LOCATION
Majestic Estates is located in the northwest quarter of Section 17, Township 6 North, Range 68
West of the 6th Principal Meridian in the City of Fort Collins, Larimer County, Colorado. More
specifically, the Majestic Estates site is a 19.90 acre property that is currently undeveloped fallow
farmland currently covered in native grasses and sparse alfalfa. The site is located to the southeast
of the Timberline Road and Trilby Road intersection, as shown on the Vicinity Map in Figure 1.
2.2 GENERAL PROJECT DESCRIPTION
The site is zoned UE (Urban Estates) and will support single family estate lots once developed. The
proposed use of the site is 8 single family estate lots and about 13.5 acres of open space.
2.3 EXISTING SITE DESCRIPTION
The vegetative cover on the site generally consists of native grasses and sparse alfalfa. The percent
density of grasses is 50%. Existing vegetation covers roughly 90% of the ground surface. The existing
site generally slopes to the east and is split into two drainage directions. The northern portion of
the site drains to the northeast corner of the property, with slopes ranging between 0.60% and
2.5%, into an existing water quality pond. The southern portion of the site sheet flows to the
southeast corner of the property, with slopes ranging between 0.60% and 2.5%, where runoff is
collected in an existing ditch and piped through existing 12” pipe under Rock Castle Lane to the
south.
2.4 SOIL AND SUBSURFACE CONDITIONS
The Majestic Estates site soils consist of loamy soil, predominately Nunn clay loam and Fort Collins
loam. Nunn clay loams belong to hydrologic soils Group C. Group C soils have a slow infiltration
rate when thoroughly wet. These consist chiefly of soils having a layer that impedes the downward
movement of water or soils of moderately fine texture or fine texture. These soils have a slow rate
of water transmission. Nunn clay loam with 0-3 percent slopes generally has a combined surface
layer thickness of approx. 30 inches. Runoff is moderately high, and the hazards of wind erosion are
moderately low. Fort Collins loams belong to the hydraulic soils Group B. Group B soils have a
moderate infiltration rate when thoroughly west. These consist mostly of moderately deep or deep,
moderately well drained or well drained soils that have moderately fine testier to moderately
coarse texture. These soils have a moderate rate of water transmission. Supporting figures can be
found in Appendix F.
The Contractor's preferred method of managing stormwater and groundwater may require a
Construction Dewatering Permit from CDPHE, or additional permits. Dewatering operations shall
not be in violation of Colorado Division of Water Resources rules and regulations regarding
exposure of groundwater. Forms are included in Appendix A.
Erosion Control Report for Majestic Estates
Page 3
2.5 WETLANDS, RECEIVING WATERS, AND ENDANGERED SPECIES
The site is shown on FEMA FIRM panel 08069C1200F which is a non-printed panel.
There are no existing irrigation ditches or wetlands associated with the site. In addition, the
project is not bordered by any existing wetlands. Therefore, no negative impacts to the wetlands
onsite or offsite are anticipated due to the construction of this project. There are no major
drainage ways located within or immediately adjacent to the site.
2.6 DESCRIPTION OF CONSTRUCTION ACTIVITY
The proposed project consists of the construction of 8 single family estate lots and associated
amenities. The project will encompass approximately 19.90 acres of disturbance. The project will
include earthwork and grading, sanitary sewer and storm drain instillation, BMP instillation.
The Contractor will be responsible for implementing and maintaining the erosion and sediment
control measures described in this document and the accompanying design drawings. The
Contractor may designate these tasks to certain subcontractors as he sees fit, but the ultimate
responsibility for implementing these controls and their proper function at each phase of the
project remains with the Contractor. Under this plan, any part of the proposed drainage
improvements may be under construction simultaneously or at separate times so long as the
necessary pollution prevention practices described in more detail in the report that follows are
followed and implemented properly.
2.7 PROPOSED SEQUENCE OF MAJOR ACTIVITIES
1. Install vehicle tracking control at the construction entrance(s). Install perimeter fencing/erosion
control measures, including silt fence where shown. Install concrete washouts. Install inlet
protection on all existing inlets.
2. Final grading earthwork
3. Utility installation in the following order:
a. Sanitary sewer
b. Storm sewer, install inlet protection
c. Dry utilities
4. Install Sidewalks
5. Place inlet protection and check dams
6. Install permanent BMPs
7. Install seeding and mulching, landscaping and final stabilization
8. Clean up
Erosion Control Report for Majestic Estates
Page 4
2.8 POTENTIAL POLLUTANTS
During construction of the new facilities, onsite storm water may be contaminated with pollutants
that could include soil sediments, slurry from saw cutting of concrete and asphalt, the washing of
exposed aggregate and concrete mix trucks, equipment fueling, washing and maintenance
operations, pavement washing and/or sealing and other related activities. These activities are
described in more detail in Section 3.6, Materials Management.
Potential sources of non-stormwater discharges include uncontaminated groundwater, construction
dewatering, concrete washout, vehicle washing and maintenance operations, and pavement washing.
If dewatering is to be discharged offsite, a separate state CDPHE dewatering permit will be
required. However, groundwater is not expected to be encountered.
Erosion Control Report for Majestic Estates
Page 5
CONTROLS
3.1 CONTROLS OVERVIEW
During construction, several controls and measures shall be implemented under the direction of the
General Contractor to prevent offsite discharge of contaminated storm water. Controls for this
project include erosion, sedimentation, stabilization, and other Best Management Practices (BMPs).
Specifications and engineering drawings for the selected BMPs can be found on the drawings
included in the back pocket of this report.
The contractor shall comply with the attached plans and guidelines as a minimum. Field conditions
and unforeseen circumstances will dictate modifications to or additions to this Erosion Control
Report. Where storm water pollution potential exists, appropriate preventative measures must be
utilized and documented, whether such measures are identified in this report or not.
3.2 EROSION AND SEDIMENT CONTROLS
The objective of erosion control is to limit the amount of erosion occurring on disturbed areas
until the site is stabilized. The objective of sediment control is to capture the soil that has been
eroded before it leaves the construction site. Despite the use of both erosion and sediment
control measures, it is recognized that some sediment could remain in runoff leaving the
construction site or result in sediment accrual within the existing storm drainage system. This
should be minimized to the maximum extent practicable.
During all phases of construction the General Contractor shall in the event of a substantial rainfall
event, provide storm water collection and conveyance systems to collect and direct sediment
contaminated water to temporary sediment traps as needed to prevent offsite discharge of
sediment laden storm water. Construction shall occur in phases as much as practicable to avoid
unnecessarily exposing vegetated areas of the site. Clean storm water, generated from stabilized
and undisturbed portions of the site, will be collected and conveyed to stabilized discharges
whenever necessary to avoid contact with disturbed portions of the site. All conveyance and
collection systems will be constructed consistent with State, Federal, and local BMP requirements.
The BMPs scheduled for use during the construction of this site can be divided into Structural and
Non-Structural Practices. Section 3.3 of this report discusses the proposed structural BMPs to be
utilized. Section 3.4 discusses the non-structural practices.
3.3 STRUCTURAL PRACTICES
Structural BMPs are structural site management practices that will minimize erosion and sediment
transport. Such practices may include silt fences, earth dikes, drainage swales, sediment traps and
basins, inlet protections, outlet protection, etc. The goal of structural BMPs on this project is to
protect areas downstream of the site from turbid water, sediment, oils and other contaminants,
which may mobilize during storm water flows. The contractor is recommended to utilize the
Erosion Control Report for Majestic Estates
Page 6
structural BMPs identified in the erosion control plans but may be required to implement additional
controls as necessary. The recommended BMPs are detailed in the Erosion Control Plans and are
described in more detail as follows, including additional BMPs as the contractor may see fit:
Silt Fence:
x A temporary vertical barrier of filter fabric attached to and supported by posts and
entrenched into the ground.
x Utilized to intercept sediment from disturbed areas during construction operations.
x Used to filter shallow sheet flow.
x Typically used along the toe of fills, in transition areas between cut and fills, and adjacent to
streams.
x Generally installed prior to or immediately following land-disturbance activity.
x Shall be inspected periodically and after each rain or snowfall event and repaired when
necessary. Sediment shall be removed from behind the fence when it accumulates to one-half
the exposed fabric height. Sediments removed must be properly disposed.
Curb Sock:
x A temporary vertical barrier of rolled wire- or geotextile-enclosed gravel or rock (also known
as curb socks).
x Utilized to intercept and filter sediment in gutters during construction operations and used as
inlet protection. Placed angling upstream in the curb to promote pooling and settling out of
sediment.
x Used as perimeter control and does not require staking.
x Very susceptible to displacement and damage from vehicular traffic. Requires frequent
inspection.
x Generally installed prior to or immediately following land-disturbance activity.
x Shall be inspected periodically and after each rain or snowfall event and repaired when
necessary. Sediment shall be removed from behind the sock when it accumulates to one-half
the exposed fabric height. Sediments removed must be properly disposed.
Inlet Protection:
x A temporary barrier across or around a storm drain drop inlet, a curb inlet, or a culvert inlet.
x Utilized to intercept and filter sediment-laden runoff and prevent it from entering storm
drainage systems.
x Not to be utilized in place of a sediment-trapping device. Used as a secondary control device.
x Do not use where ponded water might flow onto the roadway.
x Blocking of the inlet should not be watertight.
x Generally installed prior to land-disturbance activity on existing inlets and immediately after the
construction of new inlets.
x Shall be inspected periodically and after each rain or snowfall event and repaired when
necessary. Accumulated sediment shall be removed and properly disposed.
x Utilized as a temporary feature.
Erosion Control Report for Majestic Estates
Page 7
Vehicle Tracking Control / Construction Entrance:
x A temporary stabilized layer of aggregate underlined with geotextile or gravel located where
traffic enters or exits the construction site.
x The structure shall be constructed prior to any construction activity and maintained daily.
x Stone shall be added and repairs performed as conditions require.
x When mud is present and not easily removed by a tracking pad, tire washing should be
implemented as needed. Tire washing operations should occur near the construction exit on a
stabilized stone pad. Implementation of a tire washing area should include provisions for
collecting wash water and directing it to an onsite pond.
Concrete Washout Area:
x Concrete waste management involves designating and properly managing a specific area of the
construction site as a concrete washout area.
x The use of the washout site should be temporary (less than 1 year).
x The washout site should not be located in an area where shallow groundwater may be present,
such as near natural drainages, springs, or wetlands.
x Do not locate an unlined washout area within 400 feet of any natural drainage pathway or water
body or within 1,000 feet of any wells or drinking water sources.
x Remove concrete waste in the washout area, as needed to maintain BMP function.
x Upon termination of use of the washout site, accumulated solid waste, including concrete waste
and any contaminated soils, must be removed from the site to prevent on-site disposal of solid
waste. If the wash water is allowed to evaporate and the concrete hardens, it may be recycled.
Check Dam:
x Check dams are temporary grade control structures placed in drainage channels to limit the
erosivity of stormwater by reducing flow velocity. Check dams are typically constructed from
rock and wire gabion.
x Check dams are used as temporary grade control facilities along waterways until final
stabilization is established, along permanent swales that need protection prior to installation of
a non-erodible lining, along temporary channels, ditches or swales that need protection where
construction of a non-erodible lining is not practicable, and should be used in areas subject to
high flow velocities.
x When reinforced check dams are used, install erosion control fabric under and around the
check dam to prevent erosion on the upstream and downstream sides. Each section of the dam
should be keyed in to reduce the potential for washout or undermining.
x Replace missing rocks causing voids in the check dam. If gravel bags or sandbags are used,
replace or repair torn or displaced bags.
x Remove accumulated sediment, as needed to maintain BMP effectiveness.
x Check dams constructed in permanent swales should be removed when perennial grasses have
become established, or immediately prior to installation of a non-erodible lining.
Erosion Control Report for Majestic Estates
Page 8
Erosion control measures are the responsibility of the General Contractor to inspect and maintain.
Any existing erosion control devices that are removed in order to complete the construction of the
utilities shall be replaced immediately following the construction that required its removal unless
directed otherwise by the construction plans.
3.4 NON-STRUCTURAL PRACTICES
Non-Structural BMPs are both interim and permanent stabilization practices. Such practices may
include temporary seeding, permanent seeding, mulching, geotextiles, sod stabilization, vegetative
buffer strips, tree protection, preservation of mature vegetation, etc. The non-structural BMPs that
may be utilized on the subject site are described in more detail as follows:
Temporary and Permanent Seeding:
x Soil preparation, seeding, mulch tackifier and/or mulching shall be required for all disturbed
areas that are not surfaced.
x Exposed soils, which are not part of the active grading and/or construction activity, shall be
stabilized.
x Seeded areas shall be inspected frequently. If the seeded areas fail to establish, provide adequate
ground coverage. If seeded areas are disturbed, the area should be re-seeded.
x Permanent landscaping and vegetative cover is depicted on the Erosion Control plans.
Mulching:
x Application of plant residues to the soil surface. Typical mulching material includes certified
weed free hay or straw, certified under the Colorado Department of Agriculture Weed Free
Forage Certification Program as regulated by the Weed Free Forage Act, Title 35, Article 27.5,
CRS and wood cellulose fiber.
x Utilized in combination with mulch tackifier for temporary erosion control (i.e., incomplete
slopes, detour slopes, stockpiles).
x Utilized in combination with mulch tackifier for temporary erosion control on slopes when
seeding is not allowed due to seasonal constraints.
x Used to cover permanent or temporary seed areas. Hydromulch shall not be done in the
presence of free surface water.
x Inspect frequently and reapply mulching in areas where the mulching has been loosened or
removed. Mulch tackifier must be applied with additional applications of mulching.
Mulch Tackifier:
x An organic soluble powder adhesive used as a water slurry to adhere native hay, straw,
hydromulch, or seed to a surface and together.
x Used to cover disturbances as temporary cover for wind erosion.
x Mulch movement indicates poor application and procedure mixture.
x Proper application will bond mulch material together and to soil.
x Inspect by touching mulch surface to determine if adhesion has occurred.
Erosion Control Report for Majestic Estates
Page 9
Maintain Existing Vegetation:
x Existing vegetation should be preserved where possible to prevent the migration of sediment.
x Should be inspected regularly.
x Establish and maintain buffers.
x Areas beginning to show signs of erosion or soil transport may require additional emergency
BMPs.
Grading/Stockpile Techniques:
x Soil surface roughening, terracing and rounding at tops of cuts, transitions and roadway ditches
to facilitate plant establishment and minimize erosion.
x Utilized to temporarily stabilize disturbed areas and protect from wind and water erosion
immediately after grading activities have ceased.
x Used as a temporary practice during construction.
x Inspection and maintenance must be provided periodically and after each rain or snowfall event
that causes runoff to ensure roughened state is maintained.
x Rills developed should be filled and the area re-graded immediately.
Surface Roughening:
x Tracking, scarifying, imprinting, or tilling a disturbed area to provide temporary stabilization of
disturbed areas.
x Surface roughening can be used to provide temporary stabilization of disturbed areas, such as
when revegetation cannot be immediately established due to seasonal planting limitations.
x Surface roughening is not a stand-alone BMP, and should be used in conjunction with other
erosion and sediment controls.
Spill Prevention:
x Adhering to the general practices described herein so as to minimize the potential for chemical
and pollutant spills.
Sweeping:
x Public and private roadways shall be kept clear of accumulated sediment. Bulk clearing of
accumulated sediment shall not include flushing the area with water. Sediment will be shoveled
and/or swept from the street and disposed of in a manner that prevents contamination of storm
water or surface water runoff.
Dust Control:
x Wind erosion shall be controlled on the site by sprinkling and other appropriate means.
x Stockpiles and disturbed earth throughout the site may be watered regularly or as designated by
the General Contractor to eliminate/control wind erosion.
Erosion Control Report for Majestic Estates
Page 10
Education to Crew and Subcontractors:
x Crews shall be made aware of the requirements herein and shall be instructed in the spill
response procedures outlined in this report.
Trash Control:
x The site shall be made free of any trash debris, construction or otherwise and no such material
shall leave the site at any time.
Sanitary Waste Control:
x Onsite sanitary facilities/chemical toilets shall be located away from waterways. Secondary
containment shall be provided for sanitary wastes at all times.
Good Housekeeping Practices:
x Implement construction site good housekeeping practices to prevent pollution associated with
solid, liquid and hazardous construction-related materials and wastes.
x Provide for waste management.
x Establish proper building material staging areas.
x Designate paint and concrete washout areas.
x Establish proper equipment/vehicle fueling and maintenance practices.
x Control equipment/vehicle washing and allowable non-stormwater discharges.
x Develop a spill prevention and response plan.
3.5 OTHER CONTROLS
Tracking of Sediment onto Roads and Streets:
x The main construction accesses will be established on existing access road near the northeast
edge of the site. Other phased construction entrances may be utilized as depicted on the
Erosion Control plan. The accesses will be stabilized to prevent tracking of sediment offsite. All
construction vehicles entering or exiting the site will be limited to these locations.
x Public and private roadways shall be kept clear of accumulated sediment. Bulk clearing of
accumulated sediment shall not include flushing the area with water. Sediment will be shoveled
and or swept from the street and disposed of in a manner that prevents contamination of storm
water or surface water runoff.
Control Practices for Wind Erosion:
x Wind erosion shall be controlled on the site by sprinkling and other appropriate means.
x Stockpiles and disturbed earth throughout the site may be watered regularly or as designated by
the General Contractor to eliminate/control wind erosion.
Erosion Control Report for Majestic Estates
Page 11
3.6 MATERIALS MANAGEMENT
Potential Pollution Sources
It is not anticipated that construction of this project will utilize any abnormal or atypical hazardous
materials. The construction site will operate much like other typical excavation and grading
construction projects. The following materials or substances may be expected to be present onsite
during any phase of construction:
• Concrete/Additives/Wastes • Cleaning solvents
• Detergents • Petroleum based products
• Paints/Solvents • Pesticides
• Acids • Fertilizers
• Solid and construction wastes • Sanitary wastes
• Soil stabilization additives
Activities on the site that may have an impact on stormwater include the following:
• Vehicle fuels and fluids
• Equipment and/or vehicle washing
• Fertilizers, chemicals, or other material storage
• Waste storage or disposal
• Off-site and roadway vehicle tracking
• Loading/unloading areas
• Concrete truck washout
• Chemical toilets and human waste
Fueling
Vehicle fueling is not expected to be done on-site, and there is no designated area for fueling at this
time. It will be the responsibility of the contractor to designate a fueling area if needed and take the
appropriate actions to insure that no pollution of the stormwater occurs. Fueling areas shall be
located a minimum of 100 feet from all drainage courses whenever possible. Fueling areas shall be
enclosed by a 12-inch high compacted earthen ridge capable of retaining potential spills. If the
fueling area is located on soil, the area shall be covered with a non-porous lining to prevent soil
contamination.
It will be the responsibility of the contractor to designate a concrete truck cleaning area and take
the appropriate actions to insure that no pollution of the stormwater occurs. Cement truck
cleaning areas shall be located a minimum of 100 feet from all drainage courses whenever possible.
The area shall limit the travel of wash water from the area. The area shall be cleaned up of all
washed cement on an as necessary basis.
Erosion Control Report for Majestic Estates
Page 12
As construction progresses, specific areas shall be designated for vehicle maintenance and refueling,
material and waste storage, construction equipment staging, and bathroom facilities as needed.
Management measures and procedures for these facilities are discussed later in the plan. The
contractor shall mark the location of these facilities on the Erosion Control Plans located within
Appendix G of this report.
Pollution Prevention Measures
Pollution prevention measures shall be utilized to prevent construction materials with the potential
of polluting stormwater, such as those listed above, from coming in contact with runoff. Measures
include good housekeeping and proper disposal of construction and demolition debris, equipment
fuel, lubricants, paints and solvents, asphalt, concrete, topsoil and other materials, as well as
controls which prevent sediments from being tracked off-site by construction vehicles, and proper
control of any non-stormwater flows on-site.
As previously stated, BMPs are schedules of activities, prohibitions of practices, maintenance
procedures, and other management practices to prevent or reduce pollution of public waters.
BMPs also control site runoff, spillage or leaks, sludge or waste disposal, or drainage from raw
material storage. With regard to construction, these may include structural controls and
nonstructural practices that are designed to prevent pollutants from entering water or direct the
flow of water away from potential sources of pollution.
For construction sites, there are three main types of BMPs, those that prevent erosion and
sediment transport, others that prevent pollutants from construction materials from mixing with
stormwater, and those that trap pollutants before they can be discharged. BMPs for most common
construction materials and wastes with the greatest potential for adversely affecting stormwater
quality are as follows:
BMPs for Construction Waste:
x Select a designated waste collection area onsite located a minimum of 100 feet from all drainage
courses whenever possible.
x Whenever waste is not stored in a non-porous container, it shall be in an area enclosed by a 12-
inch high compacted earthen ridge.
x If the enclosed waste area is located on porous soil, the area shall be covered with a non-
porous lining to prevent soil contamination.
x Provide an adequate number of containers with lids or covers that can be placed over the
containers prior to rainfall. Whenever precipitation is predicted, the waste shall be covered with
a non-porous cover, anchored on all sides to prevent its removal by wind, in order to prevent
precipitation from leaching out potential pollutants from the waste.
x When possible, locate containers in a covered area.
x Arrange for waste collection before containers overflow.
x If a container does spill, provide cleanup immediately.
Erosion Control Report for Majestic Estates
Page 13
x Plan for additional containers and more frequent pickups during the demolition phase of
construction.
x Make sure that construction waste is collected, removed, and disposed of only at authorized
disposal areas.
x Check with local solid waste management agency for specific guidance.
x Trash, debris and spoils shall be properly contained at the end of each day.
BMPs for Hazardous Wastes Disposal:
x Check with local waste management authorities to determine what the requirements are for
disposing of hazardous materials.
x Use the entire product before disposing of the container.
x Do not remove the original product label from the container. It contains important
information.
x Do not mix products together unless specifically recommended by the manufacturer.
x The correct disposal of these products varies with the product utilized. Follow the
manufacturers recommended method, which is often found on the label.
BMPs for Hazardous Products management:
x Have equipment to contain and clean up spills of hazardous materials in the vicinity of where
these materials are to be stored or used.
x Contain and clean up spills immediately after they occur. Contact State or Local solid waste
regulatory agency concerning information and procedures necessary to treat or dispose of
contaminated soils.
x Keep materials in a dry covered area and elevated from the ground.
BMPs for residual concrete disposal:
x Emptying or wash out of excess concrete may be allowed on site. Excess concrete and wash
water should be disposed of in a manner that prevents contact between these materials and
stormwater discharges from the site.
x Residual concrete shall be discharged in specifically designated dike areas, which have been
prepared to prevent contact between the concrete and/or washout and stormwater discharged
from the site and/or ground water.
x The hardened residue from the dike areas shall be disposed of in the same manner as other
non-hazardous construction waste materials or may be broke up and utilized as deemed
appropriate by the contractor.
x The use of the washout area shall be temporary (less than one year).
x Washing of trucks and masonry equipment is to be performed only at a designated concrete
washout. No burying of wastes.
BMPs for Stockpiles:
x In the event soil is to be stored on site, it shall be in an area located a minimum of 100 feet from
all drainage courses whenever possible.
Erosion Control Report for Majestic Estates
Page 14
x The soil stockpile shall be in an area enclosed by silt fence.
x Grading techniques such as surface roughening, terracing, and rounding shall be used whenever
possible.
x Should the soil stockpile be stored longer than 30 days, it shall be temporarily covered with
mulch or a tackifier.
BMPs for Sanitary/Septic Wastes:
x Sanitary or septic wastes that are generated onsite should be treated or disposed of in
accordance with State or local requirements.
x If self-contained, temporary facilities are utilized, the domestic waste haulers should be
contracted to regularly remove the sanitary and septic wastes and to maintain the facilities in
good working order.
x Any facilities to be connected to a sanitary sewer system should be properly hooked to the
sanitary sewer system to prevent illicit discharges.
x Untreated, raw sewage should never be discharged or buried onsite.
x Contact local government and State regulatory agencies to ensure the compliance with State or
local requirements.
x If sewage is being discharged to the sanitary sewer, the local treatment works authority should
be contacted.
BMPs for pesticides:
x Store pesticides in a dry covered area and elevate above the ground.
x Provide curbs or dikes to contain possible spills.
x Have measures on site to contain and clean up spills.
x Strictly follow recommended application rates and recommended application methods.
x Only a Certified Applicator shall use pesticides.
BMPs for petroleum products:
x Fueling operations shall occur in a designated area.
x Have equipment to contain and clean up petroleum spills in fuel storage areas or on board
maintenance and fueling vehicles.
x Where possible, store petroleum products and fuel vehicles in covered areas and construct
dikes to contain spills.
x Contain and clean up spills immediately.
x Use preventive maintenance for onsite equipment such as checking for and fixing gas and oil
leaks in construction vehicles on a regular basis.
x Follow proper procedure for the handling and application of asphaltic substances.
x Oversee all filling operations.
x Fueling equipment and area shall be fenced and valves locked to prevent vandalism.
Erosion Control Report for Majestic Estates
Page 15
BMPs for Fertilizers/Detergents:
x Limit the application of fertilizers to the minimum area and minimum recommended amounts.
x Reduce exposure of nutrients to storm water runoff by working the fertilizer deep into the soil.
x Apply fertilizer more frequently, but at lower application rates.
x Hydro seeding, where lime and fertilizers are applied to the ground surface in one application
should be limited, where possible.
x Limit the use of detergents onsite: wash water containing detergents should not be discharged
to the storm system.
x Implement good erosion and sediment control to help reduce the amount of fertilizers that can
leave the site as well as sediments.
x Fertilizers and detergents shall be stored in dry and covered area and elevated above the
ground.
x Berming shall be provided around the storage area to avoid contact with stormwater runoff.
Non-Storm Water Components of Discharge
Non-storm water discharges will be eliminated or reduced to the fullest extent feasible. This plan
does not cover construction dewatering. Pumping or draining groundwater that has infiltrated into
an excavation requires a general permit for construction dewatering, regardless of the size of the
project. Stormwater that mixes with groundwater in an excavation is also subject to the controls in
the general permit for Construction Dewatering.
No materials shall be discharged in quantities that will have an adverse effect on the receiving
waters. The measures listed below will be implemented to achieve these objectives.
x Proper and lawful disposal of all waste materials.
x Control any spills and leaks that may occur and clean up (mitigate).
x Use of designated areas for equipment repair and cleaning.
x Careful application of irrigation water.
The State Stormwater discharge permit authorizes the conditional discharge of construction
dewatering to the ground, as long as the discharge flows stay on-site within the permit boundaries).
For any construction dewatering of groundwater not authorized under a separate CDPS discharge
permit, the Erosion Control Report shall clearly describe and locate the practices to be used.
Erosion Control Report for Majestic Estates
Page 16
SPILL PREVENTION AND CONTINGENCY PLAN
4.1 PURPOSE OF THE SPILL PREVENTION PLAN
This section describes measures to prevent, control, and minimize impacts from a spill of chemical
products (hazardous, toxic, or petroleum substances) during construction. This plan identifies the
handling, transportation, storage, and disposal procedures for these chemical products and outlines
response procedures to be followed in the event of a spill. This plan provides a contact list and
reporting procedures for governing agencies.
4.2 HAZARDS ASSESSMENT
Activities on the site that may have an impact on stormwater include the following:
• Vehicle fuels and fluids • Equipment and/or vehicle washing
• Fertilizers, chemicals, or other material storage • Waste storage or disposal
• Off-site and roadway vehicle tracking • Loading/unloading areas
• Concrete truck washout • Chemical toilets and human waste
• Unknown or unmarked materials
These hazards are discussed below:
Vehicle Fuels and Fluids:
The materials and fluids found in and emitted from motor vehicle operation are hazardous to humans
and wildlife. Spills of diesel fuel, gasoline, hydraulic fluid, brake fluid, engine oil, lubricants, grease, etc.,
no matter the amount, are considered serious and emergency response procedures must be initiated to
clean up the spill. These materials are toxic in liquid or vapor form and can be flammable and
combustible, so proper procedures must be followed to clean up spills. Antifreeze, Freon, and other
non-petroleum products are equally harmful and the same spill prevention and handling methods shall be
followed.
Potential sources include all construction equipment, trucks, mobile refueling trucks, and personal
vehicles. Potential causes include emergency ruptures in tanks or equipment, overflow during
refueling/replenishing fluids, seepage or ruptures from hydraulic lines, oil spills and leakage, vehicle
servicing, vehicular accidents, and natural disasters.
Equipment and/or Vehicle Washing:
Equipment washing on-site can generate sediment and pollutant-laden water. The materials and fluids
from motor vehicles can be freed during washing activities and can be present in seemingly clean wash
water. Potential sources include all construction equipment, trucks, mobile refueling trucks, and
personal vehicles. Pollutants can be generated from washing as well as from rain/snowfall and snowmelt.
Erosion Control Report for Majestic Estates
Page 17
Fertilizers, Chemicals, or Other Material Storage:
Stored fertilizers, chemical additives, acids, cement, grout, etc. are hazardous substances that require
designated and special storage areas on-site. Any untreated runoff from these areas can contain these
substances and spills can be detrimental to wildlife if not cleaned up.
Waste Storage or Disposal:
Solid waste storage and disposal is expected to occur on-site. Stormwater and snowmelt runoff that has
come in contact with solid waste can convey hazardous pollutants into receiving waters. Potential
sources include concrete, concrete formwork, treated and untreated lumber, scrap metal, electrical
equipment, etc.
Off-site and Roadway Vehicle Tracking:
Vehicle tracking on roadways, both on-site and offsite, creates sediment-laden storm runoff that has the
capacity to clog stormwater infrastructure and reduce the effectiveness of water quality and detention
features. Sources include construction vehicles, personal vehicles, and construction personnel. All dirt,
mud, sand, and sediment brought onto roads by vehicles or otherwise should be treated as a pollutant.
Loading/Unloading Areas:
Loading and unloading areas are sources for fluid and dry material spills, leaks from motor vehicles, and
dust.
Concrete Truck Washout:
Concrete washouts are sources for alkaline wastewater. The wash water and wasted concrete present
at washout locations creates hazardous and corrosive waste that can be lethal to terrestrial and aquatic
wildlife.
Chemical Toilets and Human Waste:
Human waste and the chemical additives to portable toilets are biologically hazardous substances that
affect humans and wildlife. Any spill or leakage, no matter the amount, is considered serious and
emergency response procedures must be initiated to clean up the spill. Proper disposal and disinfection
of all waste is required.
Unknown or Unmarked Materials:
The potential exists for encountering unknown or illegally buried substances and materials. These may
be in the form of storage tanks, utility lines, unmarked drums, septic system components, etc.
Personnel shall be alert to indicators of unknown hazardous wastes and materials, including
encountering resistance with equipment during excavation, noticing unusual odors during excavation, or
hearing contact with foreign materials during excavation. The hazard associated with unearthing
unknown buried materials shall be assumed high until determined otherwise. Any and all unknown
hazardous materials require special handling and emergency response procedures.
Erosion Control Report for Majestic Estates
Page 18
Spill Prevention and Containment:
Properly managing these materials onsite will greatly reduce the potential for stormwater pollution.
Good housekeeping along with proper use and storage of these construction materials form the basis
for proper management of chemical products.
The proper use of materials and equipment along with the use of general common sense greatly reduce
the potential for contaminating stormwater runoff. The following is a list of good housekeeping practices
to be used during the construction project:
x Storage of hazardous materials, chemicals, fuels, and oils and fueling of construction equipment
will not be performed within 150 feet of definitive stormwater drainage.
x An effort will be made to store only enough product required to do the job.
x Materials will be stored in a neat, orderly manner, in appropriate closed containers, in secondary
containment and, if possible, under a roof or other enclosure.
x Products will be kept in their original containers with the original manufacturer’s label.
x Substances will not be mixed with one another unless recommended by the manufacturer.
x Whenever possible, all of the product will be used up before disposing of the container.
x Manufacturer’s recommendations for proper use of a product will be followed.
x If surplus product must be disposed of, local and state recommended methods for proper
disposal will be followed.
Vehicle Fuels and Fluids:
All personnel shall be trained to maintain and inspect their vehicles and equipment, and any vehicle
found to be the source or a potential source of a spill shall be promptly removed from the construction
site and repaired, with care taken to ensure further spills do not occur on the way. Vehicles with
continual leaks shall be removed from the site until fully restored. No vehicular leaking of any kind will
be permitted on the job site. Contractors are solely responsible for any and all spills of hazardous
materials and any subsequent cleanup, disposal, restoration and remediation.
Restrictions for vehicle refueling, servicing, and maintenance operations shall be followed at all times.
Storage of hazardous materials, chemicals, fuels, and oils and fueling of construction equipment will not
be performed within 150 feet of definitive stormwater drainage. No refueling or servicing shall take
place without drip pans and absorbent material properly placed to collect leaks and spills. Any materials
required for vehicle operations and maintenance shall be stored upright in a sealed, marked, approved
storage container (the original container if possible) away from construction activities.
Any leaked fluids or collected soil containing leaked fluids shall be sealed in leak-proof containers and
taken to an appropriate site for disposal or recycling. These materials and soils shall be designated as
hazardous waste and disposed of accordingly. Under no circumstances shall contaminated soils be
added to a spoils pile, disposed of at a regular disposal site, buried on-site, or otherwise treated as non-
hazardous waste.
Erosion Control Report for Majestic Estates
Page 19
Flammable or Combustible Materials:
All products will be stored in tightly sealed containers that are clearly labeled. The containers will be
stored in secondary containment, which will be of sufficient size to contain the entire contents of the
primary container plus a sufficient quantity for precipitation (a total of approximately 110 percent of the
volume of the primary container). The secondary containment will be an impermeable containment
basin to prevent any spills or leaks from reaching the ground. The containment may be one of the
following or other means that meets the definition of impermeable: 1) a temporary earthen berm lined
with 20-ml plastic, 2) a portable tank or basin, or 3) a galvanized steel trough.
After each rain event, the contractor will inspect the contents of all secondary containment areas. If
there is no visible sheen on the collected water, it can be pumped or drained to the ground in a manner
that does not cause scouring. If a sheen is present, it must be cleaned up using absorbent materials prior
to discharging or disposing of the water. The absorbent material will be disposed of properly.
Unknown or Unmarked Materials:
Awareness of the potential for encountering unknown hazards and early recognition of potentially
hazardous materials are the best prevention for avoiding emergency spills and cleanup. Personnel shall
visually inspect excavation operations to identify any evidence of hazardous waste appearing in the soil.
Indicators include vent pipes, concrete pads, portions of drums or tanks, discolorations or stains in the
soil, and unusual or noxious odors. Personnel shall investigate the source of the indicators before
resuming activities. Any underground pipelines or tanks shall be treated with the potential to rupture,
release toxic fumes or fluid, or combust or explode. Any excavation shall be considered a confined
space when unknown materials are encountered.
The contractor is responsible for coordination with Larimer County for hazardous material disposal and
for coordination with any sanitation service or directly with any landfill for non-hazardous material
disposal.
4.3 EMERGENCY RESPONSE PROCEDURES
The contractor shall keep and maintain adequate supplies of spill containment equipment on-site.
These materials shall include specialized spill containment and cleanup kits, discussed below, and
excess erosion control measures and vacuum pumps. At a minimum, the following kit shall be kept
on-site at all times, with each construction crew, in the event a spill does occur:
x 1-55 gallon Drum
x 1 shovel
x 1 broom
x 1 pair nitrile gloves
x 1 pair safety goggles
x 4 sorbent socks
x 2 sorbent booms
Erosion Control Report for Majestic Estates
Page 20
x 1 bag sorbent granular material or peat moss
x 50 sorbent pads
x 2 sorbent pillows
x 3 disposable bags and ties with 'hazardous' labels
x (optional) If spill kit is provided by a commercial kit manufacturer, 1 emergency spill kit guide
book shall be provided.
Personnel on the site will be made aware of cleanup procedures and the location of spill cleanup
equipment. Materials and equipment needed for cleanup procedures will always be kept readily
available on the site, either at an equipment storage area or on contractor’s trucks.
In addition to the material management practices discussed previously, the following spill control
and cleanup practices will be followed to prevent stormwater pollution in the event of a spill:
x Secure the site by turning off machinery, disable hoses and pumping, and keep personnel and
traffic away from the spill. The site shall not be left unattended.
x The initial spill reporting shall be completed by the spill observer. This will determine the type
of spill and the volume and extent of the spill. The spill report form is included in Appendix D.
x A rough estimate of the volume of the spill is needed initially to determine the equipment,
personnel, and disposal needs.
x Minor spills have the lowest potential for environmental damage, not necessarily the lowest
volume.
x Spills will be contained and cleaned up immediately after discovery.
x Manufacturer’s methods for spill cleanup of a material will be followed as described on the
material’s MSDS.
x Drums and bags containing used clean up materials will be labeled with the contents and date
and shall be marked as 'hazardous'.
x The contractor will be responsible for all cleanup activities in accordance with applicable local,
state, and federal regulations.
x The first individual(s) to notice the spill shall be responsible for its reporting. All responders to
the spill must have completed training in spill recognition and hazardous material response. The
personnel to be notified and who will assist in the hazardous spill response shall include, at a
minimum, the spill observer(s) and the contractor superintendent.
Spill Categories
Minor Spills:
x Any event that involves 5 gallons or more, and/or involves the following:
x Less than the reportable quantity,
x Stays within the permitted area,
x Does not threaten any stormwater conveyances.
x Notify the City of Fort Collins Utilities Department immediately. (970) 221-6700
Erosion Control Report for Majestic Estates
Page 21
Significant Spills:
x Reportable Quantity (see SARA Title III List of Lists, available from EPA for reportable quantity)
x Any amount leaving the permitted area, or threatening any storm water conveyances.
x Notify CDPHE Incident Reporting immediately. 1-877-518-5608
x Notify the City of Fort Collins Utilities Department immediately. (970) 221-6700
x Provide written documentation within 5 days of the event.
Hazardous Spills:
x Any substance requiring a Material Safety Data Sheet (MSDS) response.
x Procedure shall include, but is not limited to:
x Secure the area.
x Provide first aid.
x Notify Emergency response personnel. 911
x Notify CDPHE Incident Reporting immediately. 1-877-518-5608
x Notify the City of Fort Collins Utilities Department immediately. (970) 221-6700
x Provide written documentation within 5 days of the event.
City of Fort Collins Utilities Department
(970) 221-6700
700 Wood St.
Fort Collins, CO 80524
Colorado Department of Public Health and Environment (CDPHE)
1-877-518-5608 (toll-free 24-hour spill reporting line)
4300 Cherry Creek Drive South
Denver, CO 80246-1530
National Response Center (24-hour)
1-800-424-8802
Regulated Storage Tanks
Owners and operators of regulated storage tank systems must report a release or suspected
release of regulated substances to the Division of Oil and Public Safety at the Colorado Department
of Labor and Employment within 24 hours. Under this program, the reportable quantity for
petroleum releases is 25 gallons or more, or any amount that causes a sheen on nearby surface
water. Spills of less than 25 gallons of petroleum must be immediately contained and cleaned up. If
cleanup cannot be accomplished within 24 hours, the Division of Oil and Public Safety must be
notified immediately.
Erosion Control Report for Majestic Estates
Page 22
The Comprehensive Environmental Response, Compensation and Liability Act (CERCLA) and the
Emergency Planning and Community Right-to-Know Act (EPCRA) require that a release of a
reportable quantity or more of a hazardous substance to the environment be reported immediately
to the appropriate authorities when the release is discovered. Spills of hazardous substances from
tanks in excess of the CERCLA or EPCRA reportable quantity must be reported immediately to the
National Response Center, CDPHE and the local fire authority, and to the Division of Oil and
Public Safety within 24 hours.
Spill Notification Contact List
Release of any chemical, oil, petroleum product, sewage, etc., which may enter waters of the State
of Colorado (which include surface water, ground water and dry gullies or storm sewers leading to
surface water), any spill that exceeds the reportable quantity, and any amount that leaves the
permitted area must be immediately reported to the Colorado Department of Public Health and
Environment (CDPHE) Water Quality Control Division (see Appendix E). Written
documentation of significant spills to both CDPHE and the City of Fort Collins Utilities Department
should be provided within 5 days.
The above information is provided as a convenience and no warranty on the accuracy or
completeness is given or should be assumed. The contractor is responsible for compiling and
updating the spill response agency contact information as needed.
4.4 CLOSING OF THE SPILL INCIDENT
Any oil, hazardous substance, or hazardous waste release that exceeds the reportable quantity must
be reported as outlined in “Reporting Chemical Spills and Releases in Colorado” (Appendix E).
The General Contractor must also modify the Erosion Control Report within 14 calendar days of
knowledge of the release:
x Provide a description of the release, the circumstances leading to the release,
x The date and time of the release,
x Weather conditions,
x Response procedure taken,
x Response personnel involved.
The plan must also be reviewed to ensure the prevention of future releases and appropriate
responses to such releases.
In the event of any violation of the State or Federal Clean Water Act rules and/or regulations that
results in fines, penalties, or expenses to the Owner, the Contractor shall reimburse the Owner for
all such fines, penalties or expenses.
Erosion Control Report for Majestic Estates
Page 23
INSPECTIONS AND MAINTENANCE
5.1 INSPECTION AND MAINTENANCE OVERVIEW
A site inspection of all erosion control facilities shall be conducted at least once every two weeks
and immediately following any significant precipitation or snowmelt event that could cause surface
erosion and every 30 days for inactive construction projects. The inspection must determine if
there is evidence of, or the potential for, pollutants entering the drainage system, and BMPs should
be reviewed to determine if they still meet the design and operational criteria in the Erosion
Control Report and that they continue to adequately control pollutants at the site. The
construction site perimeter, disturbed areas, discharge points and areas used for material storage
that are exposed to precipitation shall be inspected for evidence of, or the potential for, pollutants
entering the storm drainage system. Erosion and sediment control measures identified in this
Erosion Control Report and on the construction plans shall be observed to ensure that they are
operating correctly. Any other structural BMPs that may require maintenance, such as secondary
containment around fuel tanks or the conditions of spill response kits shall also be inspected.
Stormwater items to be inspected include the following:
x Condition & failures of structural & non-structural BMPSs
x Evidence of spills, upsets & discharges
x Maintaining accurate Erosion Control Report documentation
x Material Handling and storage
x Good Housekeeping
x Site Stabilization
x Meet authorities during inspections
x Update permit disturbed acreage
x Equipment and vehicle storage area
x Maintenance records of equipment, systems & operations
The project site and the adjacent streets impacted by the construction shall be kept neat, clean and
free of debris. The control measures and facilities need to be maintained in good working order.
Any items that are not functioning properly or are inadequate should be promptly repaired or
upgraded.
The site shall be inspected by responsible personnel who are familiar with the site. Inspection and
monitoring will follow the procedures outlined below:
Minimum Monitoring (Inspection) Requirements
x Inspections of the construction site shall be conducted by the contractor (or agent) every two
weeks and after significant storm events.
Erosion Control Report for Majestic Estates
Page 24
x Inspections are required every 30 days and after measurable storm events for sites that are no
longer under construction, but do not have 70% established ground cover.
x The qualified site superintendent familiar with this ESC/BMP shall perform the inspections.
x The contractor shall certify the site is in compliance with the ESC/BMP and the permit by:
x Ensuring that areas contributing significant storm water discharges related to the construction
activities have been identified.
x Evaluating preventive measures required by the ESC/BMP to insure they are adequate and has
been properly implemented.
x Points of discharge from the site will be inspected to check for signs of pollutant discharge.
x Certifying the grade elevations and capacity of permanent sedimentation facilities.
x Determining if additional control measures will need to be implemented.
x Updating this ESC if new measures are implemented or existing controls are deleted.
Based on the results of the inspection, the description of potential pollutant sources, and the
pollution prevention and control measures that are identified within this plan shall be revised and
modified as appropriate and as soon as practicable after such inspection. Typically corrective action
shall commence immediately when a deficiency is observed. Erosion Control Report and Map
updates shall be completed within 72 hours and BMP repairs shall be completed as soon as
practicable. Inspection report follow up information shall include the date, corrective action taken,
initials of who certified the work.
In addition to the inspections performed every 2 weeks, several daily inspections will be required.
Each day when any type of construction activity has taken place onsite, qualified personnel provided
by the General Contractor shall:
Inspect all onsite areas where petroleum products are stored, used or handled for spills and leaks
from vehicles and equipment.
Inspect all onsite locations where vehicle enter or exit the site for evidence of offsite sediment
tracking.
5.2 INSPECTION REPORTS
The General Contractor shall be responsible for the reporting of all BMP inspections. A report
summarizing the scope of each inspection, the name(s) of the personnel performing each inspection,
the qualification of personnel performing the inspection, the date(s) of the inspection, major
observation relating to the implementation of the Erosion Control Report
and actions taken shall be made and retained at the site or be readily available at a designated
alternate location until the Inactivation Notice has been submitted. All inspection reports shall be
submitted to the owner when the Inactivation Notice is filed. A recommended inspection form is
Erosion Control Report for Majestic Estates
Page 25
included in Appendix C. A separate report shall be made to identify an incident of non-
compliance.
The operator shall keep a record of inspections onsite. Uncontrolled releases of mud or muddy
water or measurable quantities of sediment found off the site shall be recorded with a brief
explanation as to the measures taken to prevent future releases as well as any measure taken to
clean up the sediment that has left the site. This record shall also include the following information:
x Dates
x Names of inspectors
x Purpose of inspection (spill event, leakage of hazardous materials, inclement weather, etc.)
x An assessment of the entire property as related to SWMP issues
x An evaluation of onsite BMPs
x Action items needed to assure the site continually complies with the SWMP guidelines
x Documentation of any suggested changes to the plan due to field conditions
x Training Events
All records related to this plan including inspection logs shall be maintained by the administrator for
a minimum of 3 years from the date that the site is finally stabilized.
Uncontrolled releases of mud or muddy water or measurable quantities of sediment found off the
site shall be recorded on the Inspection Report with a brief explanation as to the measures taken to
prevent future releases as well as any measure taken to clean up the sediment that has left the site.
All temporary and permanent erosion and sediment control facilities shall be maintained and
repaired as needed to assure continued performance of their intended function. Silt Fence and Inlet
Protection devices will require periodic maintenance and/or replacement. Sediment Traps and
water quality ponds shall be cleaned when accumulated sediments equal approximately one-half of
trap storage capacity.
After construction has been completed the inspection reports and the Erosion Control Report shall
be maintained for three years at:
_____________________________________________________________________________
(Contractor’s Name)
_____________________________________________________________________________
(Contractor’s Address)
_____________________________________________________________________________
(Contact) (Position or Title)
Erosion Control Report for Majestic Estates
Page 26
5.3 FINAL STABILIZATION AND LONG-TERM STORMWATER MANAGEMENT
Permanent stabilization will be achieved by establishing a vegetative cover on all disturbed areas.
The vegetative cover will be as specified on the Erosion Control Plans. Final stabilization shall be
considered complete when all paving and landscaping are completed and the vegetative cover has
been established with a density of at least 70 percent of pre-disturbance levels (including shrubs and
trees).
In general, spring and fall seeding is encouraged whenever possible. Temporary and permanent
seeding shall be completed within 14 days after grading has ceased and left to idle for more than 30
days. Care should be taken to complete seeding activities prior to November 1 for disturbed land
intending to remain inactive for the winter months.
Roughening and scarifying disturbed areas is allowed as a temporary stabilization with the following
conditions:
x During winter activity
x Intended to seeded in the spring fall seasons
x Intended to be active within 2-3 months of inactivity (with Stormwater approval)
x Management of storm water after completion of construction will be accomplished by utilizing
the practices listed below:
x Upon completion of construction, the site shall be inspected to ensure that all equipment, waste
materials, and debris have been removed.
The site will be inspected to make certain that all graded surfaces have been landscaped or seeded
with an appropriate ground cover.
Upon acceptance of final stabilization measures, all temporary BMPs shall be removed and proper
function of inlets, drainageways, or other storm water conveyance elements shall be restored.
The General Contractor shall be responsible for maintaining the storm water controls in good
working order including removal measures until the Inactivation Notice is filed with the State, a
copy of the Inactivation Notice is included in Appendix B. The state requires the Inactivation
Notice be filed within 3 months of the proposed end of construction. Alternatively, permit
responsibilities may be transferred or reassigned by submitting a Notice of Transfer and Acceptance
of Terms or a Reassignment of Coverage if control of a portion of the site changes parties. The
City of Fort Collins Utilities Department staff shall document and approve changes regarding
inspection frequency and closing of the CDPS permit.
Erosion Control Report for Majestic Estates
Page 28
NON-STORMWATER DISCHARGES
6.1 MANAGEMENT ANDREPORTING OF HAZARDOUS RELEASES
All potential pollutants used during construction will be handled and disposed of in a manner that
does not contaminate storm water. All materials used during construction which have the potential
to impact storm water quality will be stored, managed, used and disposed of in a manner that
minimizes the potential for releases to the environment, especially storm water.
Hazardous spills and releases shall be managed and reported in accordance with the provisions of
Section 4.0 of this report, and in conformance with all local, state, and federal requirements.
6.2 PROJECT MANAGEMENT
The contractor is responsible for all spill containment and cleanup, initiating notification and
response procedures, and all spill recognition and response training. Implementation and
management of the environmental aspects of this project under this ESC are the responsibilities of
the General Contractor. The General Contractor shall ensure the all contractors providing
services on the project have access to a copy of the ESC and appropriate training regarding storm
water pollution prevention. The General Contractor, Building Contractor, Utility Installations
Contractor, Grading Contractor and all other contractors and subcontractors shall be familiar with
the ESC and their responsibilities on the plan.
Prior to clearing and grubbing the General Contractor shall post the site information. The post
containing the site information shall be near the construction entrance and all papers shall be in a
weatherproof container.
The individual, position or title listed below shall be responsible for developing, implementing, and
maintaining, and revising the ESC. The activities and responsibilities of the administrator shall
address all aspects of the facility’s ESC.
_____________________________________________________________________________
(Contractor’s Name)
_____________________________________________________________________________
(Contractor’s Address)
_____________________________________________________________________________
(Contact) (Position or Title)
Erosion Control Report for Majestic Estates
Page 29
CONCLUSION
This Erosion Control Report has been prepared in accordance with the criteria and methods
described in the “State of Colorado General Permit Application and Stormwater Management Plan
Guidance for Stormwater Discharges Associated with Construction Activity.” The erosion control
features and best management practices have been designed to comply with City of Fort Collins
standards and specifications. All temporary and permanent erosion and sediment control BMPs
shall be inspected, maintained and repaired by the General Contractor as needed to ensure
continued performance of their intended function.
The General Contractor shall remove all temporary erosion and sediment control BMPs after
stabilization is achieved or after temporary BMPs are no longer needed. Trapped sediment will be
removed by the General Contractor or stabilized onsite. Disturbed soil areas resulting from
removal of BMPs or the General Contractor will permanently stabilize vegetation as soon as
possible.
Final stabilization shall be considered complete when all facilities are fully constructed and the
vegetative cover has been established with a density of at least 70 percent of pre-disturbance levels.
The contractor will be required to maintain the remaining BMPs for a period of one year.
The anticipated cost for installation, maintenance, and removal of the required temporary soil
erosion and sediment control measures, including dewatering and seeding and mulching, is
$74,625.00, as shown on the next page.
Erosion Control Report for Majestic Estates
Page 30
Erosion Control Report for Majestic Estates
Page 31
REFERENCES
CDOT Erosion Control and Stormwater Quality Guide; Colorado Department of Transportation, 2002.
Hydrologic Group Rating for Larimer County Area, Colorado; USDA-Natural Resources Conservation
Service, National Cooperative Soil Survey. Web Soil Survey URL: http://websoilsurvey.nrcs.usda.gov.
[July 21, 2010]
Storm Drainage Criteria Manual and Construction Standards; City of Fort Collins Storm Water Utility,
City of Fort Collins, Colorado, Updated January, 1997.
Stormwater Fact Sheet – Construction; Colorado Department of Public Health and Environment,
revised August 2007.
Urban Storm Drainage Criteria Manual Volume 3; Urban Drainage Flood Control District November
2010.
A Westrian Company
SITE
APPENDIX A
CDPS GENERAL PERMIT APPLICATION
For Agency Use Only
Permit Number Assigned
COR03-__________________________
Date Received ______/______/______
MM DD YYYY
COLORADO DISCHARGE PERMIT SYSTEM (CDPS)
STORMWATER DISCHARGE ASSOCIATED WITH CONSTRUCTION ACTIVITIES APPLICATION
PHOTO COPIES, FAXED COPIES, PDF COPIES OR EMAILS WILL NOT BE ACCEPTED.
Please print or type. Original signatures are required.
All items must be completed accurately and in their entirety for the application to be deemed complete. Incomplete applications will not be processed until all
information is received which will ultimately delay the issuance of a permit. If more space is required to answer any question, please attach additional sheets to the
application form. Applications must be submitted by mail or hand delivered to:
Colorado Department of Public Health and Environment
Water Quality Control Division
4300 Cherry Creek Drive South
WQCD-WQPS-B2
Denver, CO 80246-1530
Any additional information that you would like the Division to consider in developing the permit should be provided with the application. Examples include effluent data
and/or modeling and planned pollutant removal strategies.
Responsible Person (Title):
* PERMITTEE (if more than one please add additional pages)
COLORADO DEPARTMENT OF PUBLIC HEALTH AND ENVIRONMENT
Dedicated to protecting and improving the health and environment of the people of Colorado
Water Quality Control Division
4300 Cherry Creek Drive South
WQCD-WQPS-B2
Denver, CO 80246-1530
(303) 692– 3500 www.coloradowaterpermits.com
PERMIT INFORMATION
Reason for Application: NEW CERT RENEW CERT EXISTING CERT#
Applicant is: Property Owner Contractor/Operator
A. CONTACT INFORMATION—NOT ALL CONTACTS MAY APPLY *indicates required
* ORGANIZATION FORMAL NAME:
1) * PERMITTEE CONTACT the person authorized to sign and certify the permit application.
This person receives all permit correspondences and is the person responsible for ensuring compliance with the permit.
Currently Held By (Person): FirstName: LastName:
Telephone: Email Address:
Organization:
Mailing Address:
City: State: Zip Code:
This form must be signed by the Permittee (listed in item 1) to be considered complete.
Per Regulation 61 In all cases, it shall be signed as follows:
In the case of corporations, by a responsible corporate officer. For the purposes of this section, the responsible corporate officer is
responsible for the overall operation of the facility from which the discharge described in the application originates.
In the case of a partnership, by a general partner.
In the case of a sole proprietorship, by the proprietor.
In the case of a municipal, state, or other public facility, by either a principal executive officer or ranking elected official.
SW Construction Application for: page 1 of 5
HOW TO COMPLETE THIS APPLICATION
1. Online via web browser. You must use Internet Explorer (version 8 and above). All other browsers disable the electronic submission features.
OR
2. Download and save this form to your computer. Then open Adobe Reader (or Acrobat), select File, then Open and navigate to where the form is saved. This is the best
option if using a Mac computer (Do not use the Mac Preview program).
Responsible Person (Title):
2) DMR COGNIZANT OFFICIAL (i.e. authorized agent) the person or position authorized to sign and certify reports required by the Division
including Discharge Monitoring Reports *DMR’s, Annual Reports, Compliance Schedule submittals, and other information requested by the
Division. The Division will transmit pre-printed reports (ie. DMR’s) to this person. If more than one, please add additional pages.
Currently Held By (Person): FirstName: LastName:
Telephone: Email Address:
Organization:
Mailing Address:
City: State: Zip Code:
Same as 1) Permittee
Per Regulation 61 : All reports required by permits, and other information requested by the Division shall be signed by the permittee or by a duly
authorized representative of that person. A person is a duly authorized representative only if:
i. The authorization is made in writing by the permittee.
ii. The authorization specifies either an individual or a position having responsibility for the overall operation of the regulated facility or
activity such as the position of plant manager, operator of a well or a well field, superintendent, position of equivalent responsibility, or an
individual or position having overall responsibility for environmental matters for the company. (A duly authorized representative may thus
be either a named individual or any individual occupying a named position); and
iii. The written authorization is submitted to the Division.
Responsible Person (Title):
Currently Held By (Person): FirstName: LastName:
Telephone: Email Address:
Organization:
Mailing Address:
City: State: Zip Code:
Same as 1) Permittee
4) *BILLING CONTACT if different than the permittee.
3) *SITE CONTACT local contact for questions relating to the facility & discharge authorized by this permit
Responsible Person (Title):
Currently Held By (Person): FirstName: LastName:
Telephone: Email Address:
Organization:
Mailing Address:
City: State: Zip Code:
Same as 1) Permittee
SW Construction Application for: page 2 of 5
CO
CO
CO
B) PERMITTED PROJECT/FACILITY INFORMATION
5) OTHER CONTACT TYPES (check below) Add pages if necessary:
LastName:
Email Address:
Responsible Person (Title):
Currently Held By (Person):
Telephone:
Organization:
Mailing Address:
City: State: Zip Code:
001A Latitude
Decimal Degrees
Pretreatment Coordinator
Environmental Contact
Biosolids Responsible Party
Other:
Property Owner
Inspection Facility Contact
Consultant
Compliance Contact
Stormwater MS4 Responsible Person
Stormwater Authorized Representative
Project/Facility Name
Street Address or Cross Streets
(e.g., “S. of Park St. between 5th Ave. and 10th Ave.”, or “W. side of C.R. 21, 3.25 miles N. of Hwy 10”; A street name without an address,
intersection, mile marker, or other identifying information describing the location of the project is not adequate. For linear projects, the route of
the project should be described as best as possible with the location more accurately indicated by a map.)
Facility Latitude/Longitude - (approximate center of site to nearest 15 seconds using one of the following formats)
. 001A Longitude
Degrees (to 3 decimal places)
.
Degrees (to 3 decimal places)
(e.g., 39.703°, 104.933°)
001A Latitude o 001A Longitude
Degrees
‘
Minutes Seconds
“ o
Degrees
‘
Minutes Seconds
“ e.g., 39°46'11"N, 104°53'11"W
Degrees, Minutes, Seconds
OR
For the approximate center point of the property, to the nearest 15 seconds. The latitude and longitude must be provided as either degrees,
minutes, and seconds, or in decimal degrees with three decimal places. This information may be obtained from a variety of sources, including:
Surveyors or engineers for the project should have, or be able to calculate, this information.
EPA maintains a web-based siting tool as part of their Toxic Release Inventory program that uses interactive maps and aerial pho-
tography to help users get latitude and longitude. The siting tool can be accessed at www.epa.gov/tri/report/siting_tool/index.htm
U.S. Geological Survey topographical map(s), available at area map stores.
Using a Global Positioning System (GPS) unit to obtain a direct reading.
Note: the latitude/longitude required above is not the directional degrees, minutes, and seconds provided on a site legal description to define
property boundaries.
C) MAP (Attachment) If no map is submitted, the permit will not be issued Facility Information
Map: Attach a map that indicates the site location and that CLEARLY shows the boundaries of the area that will be disturbed. Maps must be no
larger than 11x17 inches.
D) LEGAL DESCRIPTION
Legal description: If subdivided, provide the legal description below, or indicate that it is not applicable (do not supply Township/Range/Section
or metes and bounds description of site)
Subdivision(s): Lot(s): Block(s)
Total area of project site (Acres) Area of project site to undergo disturbance (Acres)
Note: aside from clearing, grading and excavation activities, disturbed areas also include areas receiving overburden (e.g., stockpiles), demolition areas,
and areas with heavy equipment/vehicle traffic and storage that disturb existing vegetative cover
E) AREA OF CONSTRUCTION SITE
Total disturbed area of Larger Common Plan of Development or Sale. If applicable:
SW Construction Application for: page 4 of 5
Single Family Residential Development
Other—Description:
(i.e., total, including all phases, filings, lots, and infrastructure not covered by this application)
Provide both the total area of the construction site, and the area that will undergo disturbance, in acres. Note: aside from clearing, grading and excavation
activities, disturbed areas also include areas receiving overburden (e.g., stockpiles), demolition areas, and areas with heavy equipment/vehicle traffic and storage
that disturb existing vegetative cover (see construction activity description under the APPLICABILITY section on page 1). If the project is part of a larger common
plan of development or sale (see the definition under the APPLICABILITY section on page 1), the disturbed area of the total plan must also be included.
F) NATURE OF CONSTRUCTION ACTIVITY
Check the appropriate box(s) or provide a brief description that indicates the general nature of the construction activities. (The full description of activities must be
included in the Stormwater Management Plan.)
Multi-Family Residential Development
Commercial Development
Oil and Gas Production and/or Exploration (including pad sites and associated infrastructure)
Highway/Road Development (not including roadways associated with commercial or residential development)
G) ANTICIPATED CONSTRUCTION SCHEDULE
Construction Start Date: Final Stabilization Date:
Construction Start Date - This is the day you expect to begin ground disturbing activities, including grubbing, stockpiling, excavating, demolition,
and grading activities.
Final Stabilization Date - in terms of permit coverage, this is when the site is finally stabilized. This means that all ground surface disturbing
activities at the site have been completed, and all disturbed areas have been either built on, paved, or a uniform vegetative cover has been
established with an individual plant density of at least 70 percent of pre-disturbance levels. Permit coverage must be maintained until the site is
finally stabilized. Even if you are only doing one part of the project, the estimated final stabilization date must be for the overall project.
If permit coverage is still required once your part is completed, the permit certification may be transferred or reassigned to a new responsible
entity(s).
H) RECEIVING WATERS (If discharge is to a ditch or storm sewer, include the name of the ultimate receiving waters)
Immediate Receiving Water(s):
Ultimate Receiving Water(s):
Identify the receiving water of the stormwater from your site. Receiving waters are any waters of the State of Colorado. This includes all water courses, even if they
are usually dry. If stormwater from the construction site enters a ditch or storm sewer system, identify that system and indicate the ultimate receiving water for the
ditch or storm sewer. Note: a stormwater discharge permit does not allow a discharge into a ditch or storm sewer system without the approval of the owner/
operator of that system.
I) SIGNATURE PAGE
STORMWATER MANAGEMENT PLAN CERTIFICATION
Electronic Signature Ink Signature
1. You may print and sign this document and mail the hard copy to the State along with required documents.
OR
2. Electronic Submission Signature
You may choose to submit your application electronically, along with required attachments. To do so, click the SUBMIT button below which will direct you, via
e-mail , to sign the document electronically using the DocuSign Electronic Signature process. Once complete, you will receive, again via e-mail, an electronically
stamped Adobe pdf of this application. Print the signature page from the electronically stamped pdf, sign it and mail it to the WQCD Permits Section to complete
the application process (address is on page 1 of the application).
The Division encourages use of the electronic submission of the application and electronic signature. This method meets signature requirements as
required by the State of Colorado.
The ink signed copy of the electronically stamped pdf signature page is also required. This requirement meets Federal EPA Requirements.
Processing of the application will begin with the receipt of the valid electronic signature.
“I certify under penalty of law that a complete Stormwater Management Plan, as described in Appendix B of this application, has been prepared for my activity.
Based on my inquiry of the person or persons who manage the system, or those persons directly responsible for gathering the information, the Stormwater
Management Plan is, to the best of my knowledge and belief, true, accurate, and complete. I am aware that there are significant penalties for falsely certifying
the completion of said SWMP, including the possibility of fine and imprisonment for knowing violations."
Date:
Signature of Legally Responsible Person or Authorized Agent (submission must include original signature)
Name (printed) Title
"I certify under penalty of law that this document and all attachments were prepared under my direction or supervision in accordance with a system designed to
assure that qualified personnel properly gather and evaluate the information submitted. Based on my inquiry of the person or persons who manage the system, or
those persons directly responsible for gathering the information, the information submitted is to the best of my knowledge and belief, true, accurate and complete.
I am aware that there are significant penalties for submitting false information, including the possibility of fine and imprisonment for knowing violations."
“I understand that submittal of this application is for coverage under the State of Colorado General Permit for Stormwater Discharges Associated with Construction
Activity for the entirety of the construction site/project described and applied for, until such time as the application is amended or the certification is
transferred, inactivated, or expired.” [Reg 61.4(1)(h)]
DO NOT INCLUDE A COPY OF THE STORMWATER MANAGEMENT PLAN
DO NOT INCLUDE PAYMENT—AN INVOICE WILL BE SENT AFTER THE CERTIFICATION IS ISSUED.
This form must be signed by the Permittee to be considered complete. Per Regulation 61 In all cases, it shall be signed as follows:
a) In the case of corporations, by a responsible corporate officer. For the purposes of this section, the responsible corporate officer is responsible for the over
all operation of the facility from which the discharge described in the application originates.
b) In the case of a partnership, by a general partner.
c) In the case of a sole proprietorship, by the proprietor.
d) In the case of a municipal, state, or other public facility, by either a principal executive officer or ranking elected official
SW Construction Application for: page 5 of 5
3rd Party Preparer: If this form was prepared by an authorized agent on behalf of the Permittee, please complete the fields below.
Preparer Name (printed) Email Address
For Docusign
Attach Map
Attach File
Attach File
Attach File
Attach File
Application for COLORADO DISCHARGE PERMIT SYSTEM (CDPS)
General Permits:
Page 1 of 10 revised 8-2015
For Agency Use Only:
Permit Number Assigned
COG07 - _____________________
COG315 -_____________________
COG316 -_____________________
4300 Cherry Creek Drive S., Denver, CO 80246-1530 P 303-692-2000 www.colorado.gov/cdphe/wqcd
John W. Hickenlooper, Governor | Larry Wolk, MD, MSPH, Executive Director and Chief Medical Officer
Construction Dewatering (COG070000)
Remediation Activities Discharging To Surface Water (COG315000), or
Remediation Activities Discharging To Groundwater (COG316000)
Please print or type. Original signatures are required. Photo, faxed, pdf or email copies will not be
accepted.
This combined permit application is designed to streamline the application process for the three types of discharge
permits listed in Part A below, and includes an Application Guidance Document to help applicants complete the
application and select the right permit coverage for their activity. Please note that one application is intended to
cover one project and one type of permit. Where multiple projects or types of permits are required, please submit an
appropriate number of permit applications.
The application must be submitted to the Water Quality Control Division at least 30 days (for Construction Dewatering )
or 45 days (for Remediation) prior to the anticipated date of discharge, and must be considered complete by the
division before the review and approval process begins. The division will notify the applicant if additional information
is needed to complete the application. If more space is required to answer any question, please attach additional
sheets to the application form. Applications must be submitted by mail or hand delivered to:
Colorado Department of Public Health and Environment
Water Quality Control Division, WQCD-P-B2
4300 Cherry Creek Drive South
Denver, Colorado 80246-1530
A. PERMIT INFORMATION
Reason for Application: □ NEW CERT
□ RENEW CERT EXISTING CERT #
Applicant is: □ Property Owner □ Contractor/Operator
Application is for the following discharge permit (select ONE). See Guidance.
□ Construction Dewatering (COG070000)
□ Remediation Activities Discharging to Surface Water (COG315000)
□ Remediation Activities Discharging to Groundwater (COG316000)
Note: This application is designed for processing each of the three permit types listed above. The division may
request additional characterization of the proposed discharge to ensure that the appropriate permit coverage is
requested and the appropriate permit certification is issued. The division may deny or change the requested type of
discharge permit after review of the submitted application and will notify the applicant of the changes. Coverage
under the “Subterranean Dewatering or Well Development” General Permit COG6030000 is not available using this
application form.
IMPORTANT: Please read the Application Guidance Document (Guidance) for this permit application prior to completing this
application. The Guidance provides specific and important instructions required for completing this application correctly.
Application for construction dewatering or groundwater remediation coloradowaterpermits.com
Page 2 of 10 revised 3-2015
4300 Cherry Creek Drive S., Denver, CO 80246-1530 P 303-692-2000 www.colorado.gov/cdphe/wqcd
John W. Hickenlooper, Governor | Larry Wolk, MD, MSPH, Executive Director and Chief Medical Officer
B. CONTACT INFORMATION
1. Permittee Information
Organization Formal Name: ___________________________________________________________
Permittee Name: the person authorized to sign and certify the permit application. This person receives all
permit correspondences and is responsible for ensuring compliance with the permit.
Responsible Position (Title): ______________________________________________
Currently Held By (Person): ______________________________________________
Telephone No: _________________________________
Email address: ___________________________________
Mailing Address: _______________________________________________________
City: ________________________ State: ______________ Zip: _____________
This form must be signed by the permittee to be considered complete. Per Regulation 61, in all cases, it shall
be signed as follows:
a) In the case of corporations, by a responsible corporate officer. For the purposes of this section, the
responsible corporate officer is responsible for the overall operation of the facility from which the
discharge described in the application originates.
b) In the case of a partnership, by a general partner.
c) In the case of a sole proprietorship, by the proprietor.
d) In the case of a municipal, state, or other public facility, by either a principal executive officer or ranking
elected official.
2. DMR Cognizant Official (i.e. authorized agent) the person or position authorized to sign and certify reports
required by permits including Discharge Monitoring Reports [DMR’s], Annual Reports, Compliance Schedule
submittals, and other information requested by the division. The division will transmit pre-printed DMR’s to
this person. If more than one, please add additional pages.
□ Same as 1) Permittee
Responsible Position (Title): ______________________________________________
Currently Held By (Person): ______________________________________________
Telephone No: _________________________________
Email address: ___________________________________
Organization: __________________________________________________________
Mailing Address: _______________________________________________________
City: ________________________ State: ______________ Zip: _____________
Per Regulation 61: All reports required by permits, and other information requested by the Division shall be
signed by the permittee or by a duly authorized representative of that person. A person is a duly authorized
representative only if:
a) The authorization is made in writing by the permittee
b) The authorization specifies either an individual or a position having responsibility for the overall
operation of the regulated facility or activity such as the position of plant manager, operator of a well
or a well field, superintendent, position of equivalent responsibility, or an individual or position having
overall responsibility for environmental matters for the company. (A duly authorized representative may
thus be either a named individual or any individual occupying a named position)
c) Submitted in writing to the Division
COG070000/COG315000/COG316000 Permit Application www.coloradowaterpermits.com
Page 3 of 10 revised 3-2015
4300 Cherry Creek Drive S., Denver, CO 80246-1530 P 303-692-2000 www.colorado.gov/cdphe/wqcd
John W. Hickenlooper, Governor | Larry Wolk, MD, MSPH, Executive Director and Chief Medical Officer
B. CONTACT INFORMATION (cont.)
3. Site/Local Contact (contact for questions relating to the facility & discharge authorized by this permit.)
□ Same as 1) Permittee
Responsible Position (Title): ______________________________________________
Currently Held By (Person): ______________________________________________
Telephone No: __________________________________
Email address: ___________________________________
Organization: __________________________________________________________
Mailing Address: _______________________________________________________
City: ________________________ State: ______________ Zip: _____________
4. Operator in Responsible Charge Required for Groundwater Remediation COG315000 or COG316000
□ Same as 1) Permittee □ Same as 3) Site/ Local Contact
*Note: Where the division determines that coverage under the construction dewatering permit is appropriate, an ORC is not required.
Operator Number __________________ Legal Name: _________________________________________________
Telephone No: _____________________Email address: ________________________________________________
Company: __________________________________________________________
5. Billing Contact □ Same as 1) Permittee
Responsible Position (Title): ______________________________________________
Currently Held By (Person): ______________________________________________
Telephone No: __________________________________
Email address: ___________________________________
Organization: __________________________________________________________
Mailing Address: _______________________________________________________
City: ________________________ State: ______________ Zip: _____________
6. Other Contact Types (check below) Add pages if necessary:
Responsible Position (Title): ______________________________________________
Currently Held By (Person): ______________________________________________
Telephone No: __________________________________
Email address: ___________________________________
Organization: __________________________________________________________
Mailing Address: _______________________________________________________
City: ________________________ State: ______________ Zip: _____________
□ Environmental Contact
□ Facility Inspection Contact
□ Consultant
□ Compliance Contact
□ Property Owner
□ Other ____________________________________________________________
COG070000/COG315000/COG316000 Permit Application www.coloradowaterpermits.com
Page 4 of 10 revised 3-2015
4300 Cherry Creek Drive S., Denver, CO 80246-1530 P 303-692-2000 www.colorado.gov/cdphe/wqcd
John W. Hickenlooper, Governor | Larry Wolk, MD, MSPH, Executive Director and Chief Medical Officer
C. PERMITTED FACILITY INFORMATION
Facility or Project Name ____________________________________________________________________
Street Address (or cross streets) ______________________________________________________________
City__________________________________ Colorado, Zip Code __________
County __________________________________
Type of Facility Ownership
□ City Government □ Corporation □ Private □ Municipal or Water District
□ State Government □ Mixed Ownership _________________________________
Facility or Project Latitude/Longitude — List the latitude and longitude of the excavation resulting in the
discharge(s). If the exact excavation location(s) are not known, list the latitude and longitude of the center point of
the construction project. If using the center point, be sure to specify that it is the center point of construction
activity.
001A Latitude __________. _________ Longitude ___________. _____________ (e.g., 39.703°, 104.933°’)
degrees (to 6 decimal places) degrees (to 6 decimal places)
Horizontal Collection Method: □ GPS Unspecified □ Interpolation Map – Map Scale Number__________
Reference Point: □ Project/Facility Entrance □ Project/Facility Center/Centroid
Horizontal Reference Datum: __________________________________
Standard Industrial Classification (SIC) Code(s) for this FACILITY (include up to 4, in order of importance)
1__________________ 2________________3_________________4_________________
D. PROJECT DESCRIPTION
D.1. Description of Activity:
a) Provide a brief overview of the project and dewatering activity (e.g., highway, bridge and tunnel construction,
storm drain expansion, etc.).
b) Is the dewatering and discharge in-stream? (The dewatering operation is considered in-stream where the
dewatering activity is conducted within approximately the ordinary high water mark of the stream and/or on
the bank of the stream and the discharge is back to the same water body.)
□ Yes * □ No
*If yes, you must provide a description of how your project meets this definition in the box below. If no des
cription is provided, the work will not be considered in-stream. Please note that in-stream work activities
may also require a separate federal Clean Water Act Section 404 Permit and Colorado 401 Certification.
COG070000/COG315000/COG316000 Permit Application www.coloradowaterpermits.com
Page 5 of 10 revised 3-2015
4300 Cherry Creek Drive S., Denver, CO 80246-1530 P 303-692-2000 www.colorado.gov/cdphe/wqcd
John W. Hickenlooper, Governor | Larry Wolk, MD, MSPH, Executive Director and Chief Medical Officer
c) Does the activity involve work on or near existing sanitary sewer lines or septic systems?
□ Yes □ No
D.2 Description of Discharge:
a) Is the discharge to a ditch or storm sewer system? □ Yes* □ No
*If yes, the applicant must contact the owner of the ditch or storm sewer system prior to discharging to
address any local ordinances and to determine whether additional requirements will be imposed by the
owner.
b) Is the discharge to an impoundment? □ Yes* □ No
*If yes, note that discharge of contaminated groundwater to impoundments are regulated by the Solid
Waste Program in the Hazardous Materials and Waste Management Division (HMWMD), and cannot be
covered under either the Construction Dewatering or the Remediation Activities Discharging to Surface
Water or Groundwater permits.
c) Discharge Frequency and Duration:
Estimated discharge start date: _______________
Estimated discharge duration: Years _________ Months ____________ Days _____________
Will the permit coverage be transferred after construction is completed? Yes____ No ____
d) Description of Best Management Practices:
Provide a narrative description of the type(s) of treatment used for each outfall in the box below.
D.3 Discharge Outfalls Limit 20 outfalls:
Total number of defined outfalls requested: _______________
Total number of undefined outfalls requested:______________ (allowable for construction dewatering
only)
Complete Table 2a (for discharges to surface water) and/or 2b (for discharges to land with percolation to
groundwater) to identify your defined and undefined outfall locations. Attach additional pages as
necessary.
COG070000/COG315000/COG316000 Permit Application www.coloradowaterpermits.com
Page 6 of 10 revised 3-2015
4300 Cherry Creek Drive S., Denver, CO 80246-1530 P 303-692-2000 www.colorado.gov/cdphe/wqcd
John W. Hickenlooper, Governor | Larry Wolk, MD, MSPH, Executive Director and Chief Medical Officer
Table 2a – Requested Outfalls for Discharges to Surface Water (Discharges that may reach surface water through direct
discharge or through a conveyance such as a ditch or a storm sewer system)
OUTFALL
NUMBER1
NAME OF RECEIVING
STREAM(S)
(e.g., Cherry Creek,
Boulder Creek, Arkansas
River)
ESTIMATED
MAXIMUM
FLOW RATE2
(gpm)
DESCRIPTION OF DISCHARGE
LOCATION3
(e.g., Discharge enters storm sewer
located at the corner of Speer and
8th Ave. with flow to Cherry Creek)
LATITUDE/LONGITUDE
OF EACH DISCHARGE
OUTFALL
Defined Discharges to Surface Water
001-A
002-A
003-A
004-A
Undefined Discharges to Surface Water
(Available for construction dewatering only) (Provide estimated lat/long only for undefined outfalls)
001-AU
002-AU
003-AU
004-AU
1 Identify up to 20 defined or undefined outfalls (undefined for construction dewatering only). Use additional pages as
necessary.
2 For construction dewatering the maximum flow limit will be equal to twice the estimated maximum flow rate provided in
the permit application. For groundwater remediation the 30-day average flow limit will be based on the design capacity of
the treatment as provided in the permit application.
3 The discharge location is the point where effluent sampling will occur. This location must be at a point after treatment and
before the effluent joins or is diluted by any other waste stream, body of water, or substance. If the discharge is to a ditch or
storm sewer system, include the name of the ultimate receiving waters where the ditch or storm sewer discharges.
COG070000/COG315000/COG316000 Permit Application www.coloradowaterpermits.com
Page 7 of 10 revised 3-2015
4300 Cherry Creek Drive S., Denver, CO 80246-1530 P 303-692-2000 www.colorado.gov/cdphe/wqcd
John W. Hickenlooper, Governor | Larry Wolk, MD, MSPH, Executive Director and Chief Medical Officer
Table 2b – Requested Outfalls for Discharges to Land with the Potential to Percolate to Groundwater (These discharges
do not have the potential to reach surface water either directly or through a conveyance.)
OUTFALL
NUMBER1
ESTIMATED
MAXIMUM
FLOW RATE2
(gpm)
DESCRIPTION OF DISCHARGE LOCATION3
(e.g., Discharge to a field south of project site and East of I-
25)
LATITUDE/LONGITUDE
OF EACH DISCHARGE
OUTFALL
Defined Discharges to Land with Potential Percolation to Groundwater
G001-A
G002-A
G003-A
G004-A
Undefined Discharges to Land with Potential Percolation to Groundwater
(Available for construction dewatering only) (Provide estimated lat/long only for undefined outfalls)
G001-AU
G002-AU
G003-AU
G004-AU
1 Identify up to 20 defined or undefined outfalls (undefined for construction dewatering only). Use additional pages as
necessary.
2 For construction dewatering the maximum flow limit will be equal to twice the estimated maximum rate flow rate provided
in the permit application. For groundwater remediation the 30-day average flow limit will be based on the design capacity of
the treatment as provided in the permit application.
3 The discharge location is the point where effluent sampling will occur. This location must be at a point after treatment and
before the effluent joins or is diluted by any other waste stream, body of water, or substance.
COG070000/COG315000/COG316000 Permit Application www.coloradowaterpermits.com
Page 8 of 10 revised 3-2015
4300 Cherry Creek Drive S., Denver, CO 80246-1530 P 303-692-2000 www.colorado.gov/cdphe/wqcd
John W. Hickenlooper, Governor | Larry Wolk, MD, MSPH, Executive Director and Chief Medical Officer
E. ADDITIONAL INFORMATION
E.1 Nearby Sources of Potential Groundwater Contamination:
a) Has the proposed dewatering area been reviewed for possible groundwater contamination, such as plumes from
leaking underground storage tanks (LUSTs), hazardous waste sites, or additional sources other than what is
normally encountered at excavation and construction sites? Applicants are expected to exercise due diligence
in evaluating their project sites prior to applying for a discharge permit.
□ Yes □ No
b) Is an open LUST located within one-half mile of the site?
□ Yes* □ No
*If yes, BTEX analytical data for a source water sample representative of the proposed discharge at the site
must be included with the permit application. Failure to include this data may result in delays in processing
the permit application until such data is submitted to the Division. See Guidance.
c) Is a Superfund site or National Priorities List (NLP) site located within one mile of the site?
□ Yes* □ No
*If yes, analytical data for all parameters shown in Table 1 of this application (or an alternate list of
constituents approved by the division) for a source water sample representative of the proposed discharge
must be included with the permit application. Failure to include this data may result in delays in processing
the permit application until such data is submitted to the Division. See Guidance.
d) Is any other (non-LUST, non-Superfund, non-NPL site) known source of contamination, such as a Voluntary
Cleanup (VCUP), Environmental Covenant, or open Correct Action site, located within one-half mile of the
site?
□ Yes* □ No
*If yes, analytical data for all parameters shown in Table 1 of this application (or an alternate list of
constituents approved by the division) for a source water sample representative of the proposed discharge
must be included with the permit application. Failure to include this data may result in delays in processing
the permit application until such data is submitted to the Division. See Guidance.
e) If known sources of contamination are located near the site, provide an overview of the source and nature of
contamination including:
The nature of the contamination of the groundwater, alluvial water, stormwater, and/or surface water
(the source water) for which treatment and/or remedial activities will occur,
The primary industrial activities which resulted in the source water contamination,
The source of the contamination (pipes, leaking underground storage tank, up gradient sources, etc.)
or state “unknown.”
COG070000/COG315000/COG316000 Permit Application www.coloradowaterpermits.com
Page 9 of 10 revised 3-2015
4300 Cherry Creek Drive S., Denver, CO 80246-1530 P 303-692-2000 www.colorado.gov/cdphe/wqcd
John W. Hickenlooper, Governor | Larry Wolk, MD, MSPH, Executive Director and Chief Medical Officer
f) For contaminated discharges (remediation), provide a narrative description of the type(s) of treatment
proposed for use at each identified outfall.
E.2 Chemical Additions
List any chemical additives or other materials to be used in the water or to treat water prior to discharge. Include
the Material Safety Data Sheet (MSDS) for each chemical with the application.
E.3 Site Maps and Schematics
Are required maps and schematics attached? □ Yes
□ No-Application cannot be processed without required maps
A Location Map for Defined Outfalls – Application must include a location map that shows the location of the
project/facility, the location of the defined discharge point(s)/outfalls, and any receiving water(s). A north
arrow must be shown. This map must be on paper that can be folded to 8 ½ x 11 inches.
A Legible Site Sketch must be submitted that includes detailed site boundary information including street names
or mile markers, the location of dewatering or remediation activities, all defined discharge points, and sampling
locations. For undefined discharges (allowed for construction dewatering projects only), the site sketch must
include the limits of the construction site boundary and the location of potential receiving waters. This map
must be on paper that can be folded to 8 ½ x 11 inches.
Does the applicant have a Stormwater Permit for Construction Activities? □ YES □ NO □ PENDING
If Yes, Stormwater Construction Permit Number: COR-___________________
WATER RIGHTS
The State Engineers Office (SEO) has indicated that any discharge that does not return water directly to
surface waters (i.e. land application, rapid infiltration basins, etc.) has the potential for material injury to a
water right. As a result, the SEO needs to determine that material injury to a water right will not occur from
such activities. To make this judgment, the SEO requests that a copy of all documentation demonstrating
that the requirements of Colorado water law have been met, be submitted to their office for review. The
submittal should be made as soon as possible to the following address:
Colorado Division of Water Resources ● 1313 Sherman Street, Room 818 ● Denver, Colorado 80203
CHEMICAL NAME MANUFACTURER PURPOSE DOSAGE
COG070000/COG315000/COG316000 Permit Application www.coloradowaterpermits.com
Page 10 of 10 revised 3-2015
4300 Cherry Creek Drive S., Denver, CO 80246-1530 P 303-692-2000 www.colorado.gov/cdphe/wqcd
John W. Hickenlooper, Governor | Larry Wolk, MD, MSPH, Executive Director and Chief Medical Officer
Should there be any questions on the issue of water rights; the SEO can be contacted at (303) 866-3581. It is
important to understand that any CDPS permit issued by the division does not constitute a water right.
Issuance of a CDPS permit does not negate the need to also have the necessary water rights in place. It is
also important to understand that even if the activity has an existing CDPS permit, there is no guarantee that
the proper water rights are in place.
F. REQUIRED CERTIFICATION SIGNATURE [Reg 61.4(1)(h)]
"I certify under penalty of law that this document and all attachments were prepared under my direction or
supervision in accordance with a system designed to assure that qualified personnel properly gather and evaluate the
information submitted. Based on my inquiry of the person or persons who manage the system, or those persons directly
responsible for gathering the information, the information submitted is to the best of my knowledge and belief, true,
accurate and complete. I am aware that there are significant penalties for submitting false information, including the
possibility of fine and imprisonment for knowing violations."
Signature (Legally Responsible Party (Page 2 item 1) _________________________________________
Date ______________________________
Name (printed) _____________________________________________Title______________________________
This form must be signed by the permittee to be considered complete. Per Regulation 61, in all cases, it shall be
signed as follows:
a) In the case of corporations, by a responsible corporate officer. For the purposes of this section, the responsible
corporate officer is responsible for the overall operation of the facility from which the discharge described in the
application originates.
b) In the case of a partnership, by a general partner.
c) In the case of a sole proprietorship, by the proprietor.
d) In the case of a municipal, state, or other public facility, by either a principal executive officer or ranking elected
official.
Application for construction dewatering or groundwater remediation coloradowaterpermits.com
Appendix Page 1 of 2
ATTACHMENT 1
Please Submit the Laboratory Data Package for any Required Analysis with the Permit Application
(See Important Table Notes)
Required Water Quality Data
Metals PQL Metals PQL
Aluminum-Trec 50 ug/l Lead-PD 1 ug/l
Antimony-Trec NA Manganese-PD 2 ug/l
Arsenic-Trec 1 ug/l Manganese-Diss 2 ug/l
Arsenic-PD 1 ug/l Molybdenum-Trec NA
Barium-Trec 5 ug/l Nickel-Trec 50 ug/l
Beryllium-Trec 1 ug/l Nickel-PD 50 ug/l
Cadmium-Trec 1 ug/l Selenium-Trec 1 ug/l
Cadmium-PD 1 ug/l Selenium-PD 1 ug/l
Chromium III-Trec 20 ug/l Silver-Trec 0.5 ug/l
Chromium III-PD 20 ug/l Silver-PD 0.5 ug/l
Chromium VI-Trec 20 ug/l Thallium-Trec 1 ug/l
Chromium VI-Diss 20 ug/l Thallium-PD 1 ug/l
Copper-Trec and PD 5 ug/l Uranium-PD 1 ug/l
Iron-Trec 10 ug/l Uranium-Trec 1 ug/l
Iron-Diss 10 ug/l Zinc-Trec 10 ug/l
Lead-Trec 1 ug/l Zinc-PD 10 ug/l
Volatiles PQL Volatiles PQL
acrolein 15 ug/l ethylbenzene* 75 ug/l
benzene* 3 ug/l methyl bromide 5 ug/l
bromoform 3 ug/l methyl chloride 4.5 ug/l
carbon tetrachloride 3 ug/l 1,1,2,2-tetrachloroethane 2 ug/l
chlorobenzene 60 ug/l tetrachloroethylene 2.3 ug/l
chlorodibromomethane 3 ug/l toluene* 60 ug/l
2-chloroethylvinyl ether NA 1,2-trans-dichloroethylene TBD
chloroform 3 ug/l 1,1,1-trichloroethane 5 ug/l
1,2-dichlorethane 3 ug/l 1,1,2-trichloroethane 2.0 ug/l
1,1-dichlorethylene
5 ug/l trichloroethylene 2.5 ug/l
1,2-dichlorpropane 2 ug/l vinyl chloride 3 ug/l
1,3-dichlorpropylene TBD 1,4-Dioxane TBD
Semi-Volatile Organic Compounds PQL Semi-Volatile Organic Compounds PQL
acenaphthene 20 ug/l
1,2-diphenylhydrazine (as
azobenzene)
TBD
acenaphthylene 30 ug/l fluorene 20 ug/l
anthracene 20 ug/l fluoranthene 25 ug/l
benzidine 170 ug/l hexachlorobenzene 16 ug/l
benzo(a)anthracene 12 ug/l hexachlorobutadiene 9 ug/l
benzo(a)pyrene 20 ug/l hexachlorcyclopentadiene 50 ug/l
3,4-benzofluoranthene 25 ug/l hexachloroethane 16 ug/l
benzo(ghi)perylene 20 ug/l indeno(1,2,3-cd)pyrene 20 ug/l
benzo(k)fluoranthene 25 ug/l isophorone 25 ug/l
bis(2-chloroethyl)ether 15 ug/l naphthalene 20 ug/l
bis(2-chloroisopropyl)ether NA nitrobenzene 19 ug/l
bis(2-ethylhexyl)phthalate 25 ug/l N-nitrosodimethylamine 30 ug/l
COG070000/COG315000/COG316000 Permit Application www.coloradowaterpermits.com
Appendix Page 2 of 2
Semi-Volatile Organic Compounds PQL Semi-Volatile Organic Compounds PQL
Butyl benzyl phthalate 25 ug/l N-nitrosodi-n-propylamine 30 ug/l
2-chloronaphthalene 20 ug/l N-nitrosodiphenylamine 19 ug/l
chrysene 18 ug/l pyrene 10 ug/l
dibenzo(a,h)anthracene 20 ug/l 1,2,4-trichlorobenzene 20 ug/l
1,2-dichlorobenzene 2.5 ug/l 2-chlorophenol 35 ug/l
1,3-dichlorobenzene 2.5 ug/l 2,4-dichlorophenol 30 ug/l
1,4-dichlorobenzene 3.5 ug/l 2,4,-dimethylphenol 30 ug/l
3,3-dichlorobenzidine 18 ug/l 4,6-dinitro-o-cresol 17 ug/l
diethyl phthalate 20 ug/l 2,4-dinitrophenol 100 ug/l
dimethyl phthalate 20 ug/l 4-nitrophenol 25 ug/l
di-n-butyl phthalate 25 ug/l pentachorophenol 36 ug/l
2,4-dinitrotoluene 100 ug/l phenol 15 ug/l
2,6-dinitrotoluene 20 ug/l 2,4,6-trichlorophenol 25 ug/l
xylene* TBD 1,4-Dioxane TBD
*BTEX = Benzene, Toluene, Ethylbenzene, and Xylene
Important table notes:
1) Please refer to the permit application Guidance to determine whether analytical data is required with the
permit application, and if so, what specific type of data is required.
2) Abbreviations: Trec = Total Recoverable; PD = Potentially Dissolved, Diss = Dissolved, PQL = Practical
Quantitation Limit
3) Parameter names match the names as they appear in the general permit. The parameter may have a different
name in some regulations or the PQL guidance.
4) The division may require analytical data for additional parameters where the project site is located in close
proximity to potential sources of contamination for parameters not include in this Attachment 1, including but
not limited to pesticide, PCB, radionuclide contamination.
5) Benzene, toluene, ethylbenzene, and xylene are highlighted to show that they are often grouped as “BTEX”
and that data for BTEX is more commonly required than data for other parameters.
6) Applicants applying under the General Permit for Remediation Activities Discharging to Groundwater
(COG316000) are encouraged to contact the division prior to sample collection to ensure that the correct metal
speciation is included in the sample analysis.
COLORADO DISCHARGE PERMIT SYSTEM (CDPS)
Hydrostatic testing of pipelines, Tanks and Similar Vessels
Page 1 of 5
Revised 11/15
For Agency Use Only
Permit Number Assigned
COG604-____________
Date Received____/____/____
Month Day Year
PHOTO COPIES, FAXED COPIES, PDF COPIES OR EMAILS WILL NOT BE ACCEPTED.
Please print or type. Original signatures are required. This application must be considered complete by the Division prior to
initiation of permit processing. The Division will notify you if additional information is needed to complete the application.
(If more space is required to answer any question, please attach additional sheets to the application form.) Applications must be
submitted by mail or hand delivered to:
Colorado Department of Public Health and Environment
Water Quality Control Division
4300 Cherry Creek Drive South
WQCD-P-B2
Denver, Colorado 80246-1530
Any additional information that you would like the Division to consider in developing the permit should be provided with the application.
Examples include data and/or modeling regarding receiving water characteristics, data and/or modeling regarding effluent characteristics,
and planned pollutant removal strategies and their implementation timeframe. Please indicate any types of additional information that are
provided with this application below.
PERMIT INFORMATION
Reason for Application: NEW CERT
RENEW CERT EXISTING CERT #____________________
Applicant is: Property Owner Contractor/Operator
A. Contact Information
Permittee (If more than one please include additional pages)
Organization Formal Name: ___________________________________________________________
1. Permittee the person authorized to sign and certify the permit application. This person receives all permit
correspondences and is legally responsible for compliance with the permit.
Responsible Position (Title): ______________________________________________________________
Currently Held By (Person): _______________________________________________________________
Telephone No:__________________________________________________________________________
email address__________________________________________________________________________
Organization: ___________________________________________________________________________
Mailing Address: ________________________________________________________________________
City:_______________________________ State: ______________________ Zip: ____________________
This form must be signed by the Permittee to be considered complete.
Per Regulation 61: In all cases the permit application shall be signed as follows:
a) In the case of corporations, by a responsible corporate officer. For the purposes of this section, the
responsible corporate officer is responsible for the overall operation of the facility from which the
discharge described in the application originates.
b) In the case of a partnership, by a general partner.
c) In the case of a sole proprietorship, by the proprietor.
d) In the case of a municipal, state, or other public facility, by either a principal executive officer or
ranking elected official
Industrial Wastewater Discharge Permit Application – Hydrostatic Testing www.coloradowaterpermits.com
Page 2 of 5
Revised 11/15
2. DMR Cognizant Official (i.e. authorized agent)—the person or position authorized to sign and certify reports
required by permits including Discharge Monitoring Reports [DMR’s], Annual Reports, Compliance Schedule
submittals, and other information requested by the Division. The Division will send pre-printed reports (e.g. DMR’s)
to this person. If more than one, please add additional pages. Same as 1) Permittee
Responsible Position (Title): _______________________________________________________
Currently Held By (Person): ________________________________________________________
Telephone No:___________________________________________________________________
Email address____________________________________________________________________
Organization: ____________________________________________________________________
Mailing Address: _________________________________________________________________
City:______________________________ State: ______________ Zip: ______________________
Per Regulation 61: All reports required by permits, and other information requested by the Division shall be
signed by the permittee or by a duly authorized representative of that person. A person is a duly authorized
representative only if:
(i) The authorization is made in writing by the permittee;
(ii) The authorization specifies either an individual or a position having responsibility for the overall
operation of the regulated facility or activity such as the position of plant manager, operator of a well or a
well field, superintendent, position of equivalent responsibility, or an individual or position having overall
responsibility for environmental matters for the company. (A duly authorized representative may thus be
either a named individual or any individual occupying a named position); and
(iii) The written authorization is submitted to the Division.
3. Site/Local Contact—contact for questions regarding the facility & discharges authorized by this permit
Same as Permittee—Item 1
Responsible Position (Title): ________________________________________________________
Currently Held By (Person): _________________________________________________________
Telephone No:____________________________________________________________________
Email address_____________________________________________________________________
Organization: _____________________________________________________________________
Mailing Address: __________________________________________________________________
City:______________________________ State: ______________ Zip: _______________________
4. Operator in Responsible Charge Same as Permittee—Item 1
Responsible Position (Title): __________________________________________________________
Currently Held By (Person): ___________________________________________________________
Telephone No:______________________________________________________________________
Email address______________________________________________________________________
Organization: _______________________________________________________________________
Mailing Address: ____________________________________________________________________
City:_______________________________ State: ______________ Zip: ________________________
Certification Type____________________Certification Number________________________________
Industrial Wastewater Discharge Permit Application – Hydrostatic Testing www.coloradowaterpermits.com
Page 3 of 5
Revised 11/15
5. Billing Contact (if different than the permittee)
Responsible Position (Title): _____________________________________________________________
Currently Held By (Person): ______________________________________________________________
Telephone No:_________________________________________________________________________
Email address_________________________________________________________________________
Organization: __________________________________________________________________________
Mailing Address: _______________________________________________________________________
City:______________________________ State: ______________ Zip: ____________________________
6. Other Contact Types (check below) Add pages if necessary:
Responsible Position (Title): ______________________________________________________________
Currently Held By (Person): _______________________________________________________________
Telephone No:__________________________________________________________________________
Email address__________________________________________________________________________
Organization: ___________________________________________________________________________
Mailing Address: ________________________________________________________________________
City:______________________________________ State: ______________ Zip: _____________________
Pretreatment Coordinator
Environmental Contact
Biosolids Responsible Party
Property Owner
Inspection Facility Contact
Consultant
Compliance Contact
Stormwater MS4 Responsible
Person
Stormwater Authorized
Representative
Other ____________________
B. Permitted Project/Facility Information
1. Project/Facility Name ____________________________________________________________________________
Street Address or cross streets_____________________________________________________________________
City, State and Zip Code _____________________________________________County _____________________
Type of Facility Ownership
City Government Corporation Private Municipal or Water District
State Government Mixed Ownership _________________________________
Directions from nearest major cross streets
3. Facility Latitude/Longitude—List the latitude and longitude of the facility from which the discharge will occur. If the
permit applicant is applying for a ‘Statewide’ permit (Fire Suppression Related Discharges), list the Latitude/Longitude
of the company address.
001A Latitude __________ . _________ Longitude ___________ . _____________ (e.g., 39.70301°, 104.93323°’)
degrees (to5 decimal places) degrees (to 5 decimal places)
4. Standard Industrial Classification (SIC) Code, (Include up to four in order of importance)
1. _____________ 2. _____________ 3._____________ 4. _____________
Industrial Wastewater Discharge Permit Application – Hydrostatic Testing www.coloradowaterpermits.com
Page 4 of 5
Revised 11/15
C. Discharge Related Information
1. Date the discharge is expected to begin _______________
2. Estimate how long discharge will last Years____________Months_______________Days_________________
3. Is this a ONE TIME Discharge? YES NO
If recurring, what is the frequency?
Is the pipeline, tank or vessel that is being hydrostatically tested (or drained) used or new? Used New
4. If the pipeline, tank or vessel is used, what type of product was in the pipeline/tank?______________________
5. What material is the pipeline/tank being tested (e.g. steel, PVC, etc.)? _________________________________
6. Describe Activity: e.g., discharge is hydrostatic test water from used natural gas pipelines, discharge is hydrostatic test water
from a 1,000 gallon tank
7. Identify the source of the water being used in the testing eg potable water, well water, groundwater, river water, etc.
8. Identify any chemicals used in the testing. Attach material safety data sheets (MSDSs) for all proposed chemicals. The Division will
review all MSDSs prior to approval.
9. Will the discharge go to a ditch storm sewer, or any other type of conveyance? YES NO
If YES, in the following table include the name of the ultimate receiving waters where the ditch discharges.
10. Discharge Information: In the following table, include the following information for the discharge: (See Instructions)
Include the number of discharge points (use a separate piece of paper if necessary)
Include the latitude and longitude of each discharge point
Include structure type – New, Used, or Both
Include the name of the receiving stream(s)
Include the volume of water to be discharged or the estimated flow of the discharge in gallons per minute
.
OUTFALL
NUMBER
Latitude
Dec.degrees
Longitude
- Dec.degrees
Are Structures
New, Used, or
Both
Receiving Stream
Flow rate
(gpm)
Total volume
001
002
003
*Indicate whether hydrostatic testing/flushing is occurring on structures (e.g., pipelines, tanks, and/ or other
similar Vessels) that are NEW, USED, or BOTH new and used.
**Indicate whether the discharge is to surface water (SW) and name the receiving stream, or to ground water (GW).
Hydrostatic Testing of Pipelines, Tanks, and Similar Vessels Industrial WasteWater Application coloradowaterpermits.com
Page 2 of 5
Revised 11/15
D. A Location Map designating the location of the construction site and the discharge(s) to the receiving
water(s) listed in Item 8. A north arrow shall be shown. This map must be on paper 8-1/2 x 11 inches.
Map is attached YES
A Legible Sketch of the site shall be submitted and include the location of the end of pipe dewatering
discharge at the site (e.g. where the flow will be discharges from the pump of BMP), the BMP(s) that will be
used to treat the discharge(s), and the sampling location(s). Refer to the instructions for additional guidance
specific to sites with multiple potential dewatering locations. This map must be on paper 8-1/2 x 11 inches.
Sketch is attached YES
Note to the applicant: Upon review of the application, the Division may request additional discharge information, or analysis of
certain parameters once the application has been reviewed. If the Division requests a representative analysis of the water which
will be discharged, the application processing time may be lengthened.
WATER RIGHTS
The State Engineers Office (SEO) has indicated that any discharge that does not return water directly to surface waters (i.e.
land application, rapid infiltration basins, etc.) has the potential for material injury to a water right. As a result, the SEO
needs
to determine that material injury to a water right will not occur from such activities. To make this judgment, the SEO requests
that a copy of all documentation demonstrating that the requirements of Colorado water law have been met, be submitted to
their office for review. The submittal should be made as soon as possible to the following address:
Colorado Division of Water Resources
1313 Sherman Street, Room 818
Denver, Colorado 80203
Should there be any questions on the issue of water rights, the SEO can be contacted at (303) 866-3581. It is important to
understand that any CDPS permit issued by the Division does not constitute a water right. Issuance of a CDPS permit does not
negate the need to also have the necessary water rights in place. It is also important to understand that even if the activity has
an existing CDPS permit, there is no guarantee that the proper water rights are in place.
G. REQUIRED SIGNATURES:
Signature of Applicant: The applicant must be either the owner and/or operator of the site. Refer to Part B of the
instructions for additional information. The application must be signed by the applicant to be considered complete. In
all cases, it shall be signed as follows: (Regulation 61.4 (1ei)
a) In the case of corporations, by the responsible corporate officer is responsible for the overall operation of
the facility from which the discharge described in the form originates
b) In the case of a partnership, by a general partner.
c) In the case of a sole proprietorship, by the proprietor.
d) In the case of a municipal, state, or other public facility, by either a principal executive officer, ranking
elected official, (a principal executive officer has responsibility for the overall operation of the facility from
which the discharge originates).
“I certify under penalty of law that I have personally examined and am familiar with the information submitted in this
application and all attachments and that, based on my inquiry of those individuals immediately responsible for
obtaining the information, I believe that the information is true, accurate and complete. I am aware that there are
significant penalties for submitting false information, including the possibility of fine or imprisonment.
Signature of Legally Responsible Person (submission must include original signature) Date Signed
Name (printed) Title
COLORADO DEPARTMENT OF PUBLIC HEALTH AND ENVIRONMENT
Water Quality Control Division – Stormwater Program
Revised 4/2011
STORMWATER DISCHARGES ASSOCIATED WITH CONSTRUCTION ACTIVITY
STORMWATER MANAGEMENT PLAN PREPARATION GUIDANCE
Revised 4/2011
Contact information
Colorado Department of Public Health and Environment
Water Quality Control Division – Stormwater Program
WQCD-Permits-B2
4300 Cherry Creek Drive South
Denver, Colorado 80246-1530
Telephone: (303) 692-3517
Email: cdphe.wqstorm@state.co.us
Web Page: www.cdphe.state.co.us/wq/PermitsUnit
CONTENTS
Applicability
Appendix A – Preparing a Stormwater Management Plan (SWMP)
APPLICABILITY
This application is for use by all entities engaged in construction activities to obtain coverage under the general permit for
Stormwater Discharges Associated with Construction Activities (the Stormwater Construction Permit). Construction
activity refers to ground surface disturbing activities, which include, but are not limited to, clearing, grading, excavation,
demolition, installation of new or improved haul roads and access roads, staging areas, stockpiling of fill materials, and
borrow areas. Construction does not include routine maintenance to maintain original line and grade, hydraulic capacity,
or original purpose of the facility.
Stormwater Construction Permit coverage is required by State and Federal regulations for stormwater discharged from
any construction activity that disturbs at least 1 acre of land (or is part of a larger common plan of development or sale
that will disturb at least 1 acre). A ―common plan of development or sale‖ is a site where multiple separate and distinct
construction activities may be taking place at different times on different schedules, but still under a single plan. This
includes phased projects, projects with multiple filings or lots, and projects in a contiguous area that may be unrelated but
still under the same contract. If the project is part of a common plan of development or sale, the disturbed area of the
entire plan must be used in determining permit requirements, and all portions of the project must be covered.
NOTES:
Stormwater Management Plan Preparation Guidance – The guidance, available as Appendix A to this application,
has been revised and updated.
Additional Guidance – Additional information, including further discussion on permittee and operator liability, is
available in the Stormwater Fact Sheet – Construction, available from the Division‘s web site at
www.cdphe.state.co.us/wq/PermitsUnit. If you have questions on completing this application, you may contact the
Division at cdphe.wqstorm@state.co.us or (303) 692-3517.
Water Quality Control Division – Stormwater Program www.cdphe.state.co.us/wq/permitsunit
Instructions – Page 2 of 3 Revised 6/2011
INSTRUCTIONS
A) Submitting the Application
Application Due Date: At least ten days prior to the anticipated start of construction, the owner or operator of the
construction activity must submit an application as provided by the Water Quality Control Division (Division). This
form may be reproduced, and is also available from the Division‘s web site (see previous page for address/contact
information). Applications received by the Division are processed, and a permit certification and other relevant
materials will be sent to the attention of the legally responsible person .
Permit Fee: Do not send any payment with this application. You will be billed once you are covered under a
permit. Current permit fees can be obtained from the Division‘s web site at www.cdphe.state.co.us/wq/PermitsUnit.
Application Completeness: The application must be completed accurately and in its entirety or the application will
be deemed incomplete—processing of the application will not begin until all required information is received. One
original copy of the completed application (no faxes or e-mails) must be submitted to the Division to initiate the
application process (see page 1 above for address/contact information).
Do not include a copy of the Stormwater Management Plan, unless requested by the Division.
B) Who May Apply For and Maintain Permit Coverage
The Permit applicant must be a legal entity that meets the definition of the owner and/or operator of the
construction site, in order for this application to legally cover the activities occurring at the site. The applicant
must have day-to-day supervision and control over activities at the site and implementation of the SWMP.
Although it is acceptable for the applicant to meet this requirement through the actions of a contractor, as
discussed in the examples below, the applicant remains liable for violations resulting from the actions of their
contractor and/or subcontractors. Examples of acceptable applicants include:
Owner or Developer - An owner or developer who is operating as the site manager or otherwise has
supervision and control over the site, either directly or through a contract with an entity such as those listed
below.
General Contractor or Subcontractor - A contractor with contractual responsibility and operational
control (including SWMP implementation) to address the impacts construction activities may have on
stormwater quality.
Other Designated Agents/Contractors - Other agents, such as a consultant acting as construction manager
under contract with the owner or developer, with contractual responsibility and operational control (including
SWMP implementation) to address the impacts construction activities may have on stormwater quality.
An entity conducting construction activities at a site may be held liable for operating without the necessary
permit coverage if the site does not have a permit certification in place that is issued to an owner and/or
operator. For example, if a site (or portion of a site) is sold or the contractor conducting construction activities
changes, the site‘s permit certification may end up being held by a permittee (e.g., the previous owner or
contractor) who is no longer the current owner and/or operator. In this case, the existing permit certification
will no longer cover the new operator‘s activities, and a new certification must be issued, or the current
certification transferred.
Utilities, Other Subcontractors, etc.: A separate permit certification is not needed for subcontractors, such as
utility service line installers, where the permittee or their contractor is identified as having the operational
control to address any impacts the subcontractor‘s activities may have on stormwater quality. Although separate
permit coverage may not be needed in some cases, these entities are not exempt from the stormwater regulations
for all of their projects and may still be held liable if their activities result in the discharge of pollutants.
Leases: When dealing with leased land or facilities, the lessee shall be considered the ―woner‖ for the purposes
of stormwater permitting if they are responsible for the activities occurring at the site.
Water Quality Control Division – Stormwater Program www.cdphe.state.co.us/wq/permitsunit
Instructions – Page 3 of 3 Revised 6/2011
C) Permitting for Developments with Multiple Owners and/or Operators
For situations where multiple entities meet the definition of owners and/or operators for different portions of a
development (e.g., a single development with multiple lots owned and operated by separate entities), it is essential
that the permittees, owners, and operators at the site correctly follow the guidance on who may apply for coverage
under the Stormwater Construction Permit (see Part B, above).
When a portion of a permitted site is sold to a new owner, a permit certification must be in place that is held by an
entity meeting the definition of owner and/or operator of that sold lot. This may be accomplished in one of the
following ways:
Coverage Under the Existing Certification – Activities at the sold area may continue to be covered under an
existing permit certification for the project if the current permittee meets the definition of operator for the sold
area. To meet the definition of operator, the current permittee must have contractual responsibility and
operational control to address the impacts that construction activities at the sold area may have on stormwater
runoff (including implementation of the SWMP for the sold area). Therefore, a legally binding agreement must
exist assigning this responsibility to the current permit holder on behalf of the new owner and/or operator for the
sold area. It is not necessary to notify the Division in such case. However, documentation of the agreement must
be available upon request, and the SWMP must be maintained to include all activities covered by the Stormwater
Construction Permit
New Certification Issued – Reassignment – A new permit certification may be issued to the new owner and/or
operator of the sold area. The existing permittee and the new owner and/or operator must complete the
Reassignment Form (available from the Division‘s web page, see page 1) to remove the sold area from the
existing permit certification and cover it under a certification issued to the owner and/or operator of the sold area.
Both entities must have SWMPs in place that accurately reflect their current covered areas and activities.
A more detailed explanation is available in the Stormwater Fact Sheet – Construction, available from the Division‘s
web site (see page 1).
This certification includes an acknowledgment that the applicant understands that the permit coverage, and
therefore the applicant’s liability, will be for the entirety of the construction project described and
applied for, until such time as the application is amended or the certification is transferred,
inactivated, or expired.
Detailed instructions for filling out the application are included in the application.
Water Quality Control Division – Stormwater Program www.cdphe.state.co.us/wq/permitsunit
Appendix A - Page 1 of 20 Revised 6/2011
APPENDIX A
SWMP GUIDANCE
PREPARING A STORMWATER MANAGEMENT PLAN (SWMP)
Stormwater Construction General Permit
Contents
A. INTRODUCTION ..................................................................................................................................... page 2
B. GENERAL GUIDANCE ................................................................................................................................... 2
BMPs ......................................................................................................................................................... 2
Special topic:
Erosion Control BMPs, Sediment Control BMPs ................................................................... 3
Implementation .......................................................................................................................................... 3
Common Sense Approach ......................................................................................................................... 3
SWMP Items, Format ................................................................................................................................ 3
Existing Controls ....................................................................................................................................... 3
Control Implemented by Other Parties....................................................................................................... 3
SWMP Availability ................................................................................................................................... 4
C. STORMWATER MANAGEMENT PLAN REQUIRMENTS ..................................................................... 4
C.1 SWMP GENERAL REQUIREMENTS ...................................................................................................... 4
C.2 SWMP CONTENTS – Narrative Site Description ...................................................................................... 5
C.3 SWMP CONTENTS – Site Map ................................................................................................................. 6
Special topic: Using Construction Plans, Plans Developed to Meet Local
Stormwater Requirements, or Other Plans ........................................................................... 6
C.4 SWMP CONTENTS – Stormwater Management Controls ......................................................................... 7
a. SWMP Administrator .......................................................................................................................... 7
b. Identification of Potential Pollutant Sources ........................................................................................ 8
c. Best Management Practices (BMPs) for Stormwater Pollution Prevention ....................................... 10
i) Selecting and locating appropriate BMPs .................................................................................. 10
ii) Specific BMPs for Material Handling and Spill Prevention ...................................................... 10
Special topics:
BMP location ...................................................................................................................... 11
Ensuring BMPs are under the Control of the Permittee ................................................. 11
Protecting Waters of the United States .............................................................................. 11
iii) Documenting Selected BMPs in the SWMP (including phasing of BMP implementation) ...... 12
Special topic: BMP description: Level of detail ................................................................. 12
iv) Non-Stormwater Discharges ...................................................................................................... 12
Concrete Washout water ..................................................................................................... 12
Construction Dewatering water ........................................................................................... 12
v) Stormwater Dewatering: ............................................................................................................ 13
d. Revising BMPs and the SWMP ......................................................................................................... 13
C.5 SWMP CONTENTS – Final Stabilization and Long-term Stormwater Management ............................... 14
Special topic: Inactivation of permit coverage ................................................................... 14
Special topic: Use of Permanent Detention Ponds as BMPs during Construction .......... 15
C.6 SWMP CONTENTS – Inspection and Maintenance Procedures ............................................................... 15
a. Inspection Schedules .......................................................................................................................... 15
b. Inspection Procedures ........................................................................................................................ 15
c. BMP Maintenance/Replacement and Failed BMPs .......................................................................... 16
d. Record Keeping and Documenting Inspections ................................................................................. 16
Water Quality Control Division – Stormwater Program www.cdphe.state.co.us/wq/permitsunit
Appendix A - Page 2 of 20 Revised 6/2011
Uncontrolled storm water discharges from
areas of urban development and construction
activity negatively impact receiving waters by
changing the physical, biological, and chemical
composition of the water, resulting in an
unhealthy environment for aquatic organisms,
wildlife, and humans.
D. ADDITIONAL SWMP AND BMP RESOURCES ....................................................................................... 17
D.1. RESOURCES – BMP Design and Implementation ................................................................................... 17
a. BMP Design Criteria Manuals: .......................................................................................................... 17
b. General BMP Selection and Design Guidance .................................................................................. 18
c. Special Applications .......................................................................................................................... 18
D.2. RESOURCES – Example Management Plans ........................................................................................... 19
D.3. RESOURCES – Training........................................................................................................................... 19
A. INTRODUCTION
This guidance document is designed to help you develop a Stormwater Management Plan (SWMP) for your construction
project, as required for compliance with the CDPS general permit for Stormwater Discharges Associated with Construction
Activities (the Stormwater Construction Permit). It explains what each of the SWMP requirements means, and gives some
options for you to consider in developing Best Management Practices (BMPs) that are best suited to your site during
construction.
This guidance document primarily addresses the SWMP requirements in the Stormwater Construction Permit. Other
requirements and limitations, such as records retention, reporting, inspections, etc., are detailed in the Stormwater Construction
Permit itself. Also note that the SWMP and the Stormwater Construction Permit only cover discharges of stormwater.
Stormwater Management Plan (SWMP) Goal: To identify possible pollutant sources that may contribute pollutants
to stormwater, and identify Best Management Practices (BMPs) that, when implemented, will reduce or eliminate any
possible water quality impacts. The SWMP must be completed and implemented at the time the project breaks ground,
and revised as construction proceeds, to accurately reflect the conditions and practices at the site.
Construction activities use and produce many different kinds of pollutants which may impact water quality. The main
pollutant of concern at construction sites is sediment. Grading activities remove grass, rocks, pavement and other protective
ground covers, resulting in the exposure of underlying soil to the elements. The soil is then easily picked up by wind and/or
washed away by rain or snowmelt. For example, sediment runoff rates from construction sites are typically 10 to 20 times
greater than those from agricultural lands, and 1,000 to 2,000 times greater than those of forest lands. During a short period of
time, construction activity can contribute more sediment to streams than would normally be deposited over several decades,
causing physical and biological harm to our State‘s waters. The added sediment chokes the river channel and covers the areas
where fish spawn and plants grow. Excess sediment can cause a
number of other problems for waterbodies, such as increased
difficulty in filtering drinking water, and clouding the waters
which can kill plants growing in the river and suffocate fish. A
number of pollutants, such as nutrients, are absorbed onto
sediment particles and also are a source of pollution associated
with sediment discharged from construction sites.
In addition, construction activities often require the use of toxic or
hazardous materials such as petroleum products, fertilizers, pesticides and herbicides, and building materials such as asphalt,
sealants and concrete, which may pollute stormwater. These materials can be harmful to humans, plants and aquatic life.
B. GENERAL GUIDANCE
BMPs: Best Management Practices (BMPs) encompass a wide range of erosion and sediment control practices, both
structural and non-structural in nature, that are intended to reduce or eliminate any possible water quality impacts from
stormwater leaving a construction site. The individual BMPs appropriate for a particular construction site are largely
dependant of the types of potential pollutant sources present, the nature of the construction activity, and specific-site
conditions.
Water Quality Control Division – Stormwater Program www.cdphe.state.co.us/wq/permitsunit
Appendix A - Page 3 of 20 Revised 6/2011
Best Management Practices to prevent the
erosion and discharge of sediment typically
include:
1. Erosion Control BMPs
Practices to prevent the erosion of soil.
Examples:
minimizing the amount of disturbed soil
through phasing, temporary stabilization, or
leaving existing vegetation
diverting runoff around disturbed areas
2. Sediment Control BMPs
Practices to remove sediment from runoff.
Examples:
retaining stormwater in ponds or behind silt
fence to settle out sediment
filtering stormwater through filter fabric on
inlets
Nonstructural BMPs, such as preserving natural vegetation,
preventive maintenance and spill response procedures, schedules of
activities, prohibition of specific practices, education, and other
management practices are mainly operational or managerial
techniques.
Structural BMPs include treatment processes and practices
ranging from diversion structures and silt fences, to retention ponds
and inlet protection.
Most of the BMPs referenced here are widely used in the
construction industry. They generally involve a simple and low
cost approach, and can be very effective when properly installed
and maintained.
The Stormwater Construction Permit requires the use of a self-
designed SWMP. This plan is based on the use of BMPs. For
construction sites, there are several types of BMPs: those that
prevent erosion, those that prevent construction materials from
introducing pollutants to stormwater, and those that remove
sediment and other pollutants before they can be discharged (see box, to right).
Implementation: The SWMP focus is primarily on controls used during ground surface disturbing activities. This focus
means that many sediment control BMPs, such as silt fence and inlet protection, must be installed before disturbing activities
begins, not after.
Common Sense Approach: Your SWMP is intended to be a usable document, not a paper exercise. Therefore, do not
include practices that may sound good, but are unreasonable or not feasible for your site. Failure to implement your SWMP,
even if the BMPs listed do not make sense, puts you in automatic violation of the Stormwater Construction Permit. For
example, a blanket statement that runoff from all disturbed areas will be controlled by silt fences, even if the slope or channels
are too steep/narrow for this particular BMP, would be unreasonable.
On the other hand, if a particular BMP is listed in the SWMP, but then later turns out to be impractical or ineffective, the
SWMP must be amended to reflect the changes/improvements made.
SWMP Items, Format: When preparing your plan, make sure to address each item included in this guidance. If it is not
applicable to your site, briefly explain why. A simple "Not Applicable" is not enough. Failure to address each item is a
violation of the Stormwater Construction Permit.
In addition, your SWMP should follow the same format as the SWMP requirements listed in Section C, below. That is, even if
you are using an existing document (such as plans and specs) that addresses the required SWMP items, you should include a
cross-reference for each of the SWMP items that indicates where it can be found in your existing document. You must be
able to provide all required components of the SWMP to a State, EPA, or local agency inspector at your site, so the location
and format of the information must be clear to the site personnel in charge of SWMP implementation.
Existing Controls: Note that the SWMP should include any existing stormwater controls at your site, not just new or
proposed ones. It can also include any erosion, sediment or drainage controls which are required by other regulations, such as
local erosion and sediment control ordinances, if you are also using them to meet the SWMP requirements.
Control Implemented by Other Parties: A permittee will often have to rely on controls implemented by other parties to
ensure adequate management of stormwater runoff. For example, if a permit certification is obtained to cover a lot in a larger
Water Quality Control Division – Stormwater Program www.cdphe.state.co.us/wq/permitsunit
Appendix A - Page 4 of 20 Revised 6/2011
agreements must exist between the permittee and the party implementing the BMP(s) to ensure adequate operation and
maintenance of those BMPs. Additional guidance is available in the Stormwater Fact Sheet for Construction, available from
the Division‘s web site at www.cdphe.state.co.us/wq/PermitsUnit.
SWMP Availability: A copy of the SWMP must be kept on site, readily available to the operator, and to Division or EPA
personnel for review during inspections. City, county, and local agencies may also request the SWMP as part of a local
oversight program. If an office location is not available at the site, the SWMP must be managed so that it is available at the
site when construction activities are occurring (e.g., by keeping the SWMP in a superintendent‘s vehicle.)
C. STORMWATER MANAGEMENT PLAN REQUIRMENTS
In this section, the text in italics, and marked with the Permit banner, is quoted directly from the Stormwater Construction
Permit. The text in standard typeface is provided as guidance in the preparation of your SWMP. The references (Part I.C, for
example) correspond to the location of the item in the Stormwater Construction Permit, unless it specifically references a
section in this document.
C.1 SWMP GENERAL REQUIREMENTS
Permit
Part I.B Stormwater Management Plan (SWMP) - General Requirements
1. A SWMP shall be developed for each facility covered by this permit. The SWMP shall be prepared in accordance with
good engineering, hydrologic and pollution control practices. (The SWMP need not be prepared by a registered
engineer.)
2. The SWMP shall:
a) Identify all potential sources of pollution which may reasonably be expected to affect the quality of stormwater
discharges associated with construction activity from the facility;
b) Describe the practices to be used to reduce the pollutants in stormwater discharges associated with construction
activity at the facility; and ensure the practices are selected and described in accordance with good engineering
practices, including the installation, implementation and maintenance requirements; and
c) Be properly prepared, and updated in accordance with Part I.D.5.c, to ensure compliance with the terms and
conditions of this permit.
3. Facilities must implement the provisions of the SWMP as written and updated, from commencement of construction
activity until final stabilization is complete, as a condition of this permit. The Division reserves the right to review the
SWMP, and to require the permittee to develop and implement additional measures to prevent and control pollution as
needed.
4. The SWMP may reflect requirements for Spill Prevention Control and Countermeasure (SPCC) plans under section
311 of the CWA, or Best Management Practices (BMPs) Programs otherwise required by a separate CDPS permit, and
may incorporate any part of such plans into the SWMP by reference, provided that the relevant sections of such plans are
available as part of the SWMP consistent with Part I.D.5.b.
For any sites with permit coverage before June 30, 2007, the permittee’s SMWP must meet the new SWMP requirements as
summarized in Section II.I of the rationale. Any needed changes must be made by October 1, 2007.
The General Requirements section provides the broad expectations for the preparation, contents and implementation of a
SWMP. The specific items that must be included in the SWMP are addressed in the SWMP Contents sections below.
Water Quality Control Division – Stormwater Program www.cdphe.state.co.us/wq/permitsunit
Appendix A - Page 5 of 20 Revised 6/2011
C.2 SWMP CONTENTS – Narrative Site Description
Permit
Part I.C.1 Stormwater Management Plan (SWMP) – Contents: Site Description
The SWMP shall include the following items, at a minimum:
Site Description. The SWMP shall clearly describe the construction activity, to include:
a) The nature of the construction activity at the site.
b) The proposed sequence for major activities.
c) Estimates of the total area of the site, and the area and location expected to be disturbed by clearing, excavation,
grading, or other construction activities.
d) A summary of any existing data used in the development of the site construction plans or SWMP that describe the
soil or existing potential for soil erosion.
e) A description of the existing vegetation at the site and an estimate of the percent vegetative ground cover.
f) The location and description of all potential pollution sources, including ground surface disturbing activities
(see Part I.A.2.b), vehicle fueling, storage of fertilizers or chemicals, etc.
g) The location and description of any anticipated allowable sources of non-stormwater discharge at the site, e.g.,
uncontaminated springs, landscape irrigation return flow, construction dewatering, and concrete washout.
h) The name of the receiving water(s) and the size, type and location of any outfall(s). If the stormwater discharge
is to a municipal separate storm sewer system, the name of that system, the location of the storm sewer
discharge, and the ultimate receiving water(s).
This part requires a narrative description of the overall scope and physical characteristics of the project, as follows:
a) Include a description of the construction activities at the site (e.g., type of project, a summary of the grading activities,
installation of utilities, paving, excavation, landscaping, etc) and the final disposition of the property.
b) Describe the sequence of events involved in the construction project, such as grading, excavation, etc.
c) This information, which is also required in the application, is useful in determining the extent of control measures needed.
d) Data describing soils or erosion potential will typically not be needed. This information only needs to be included if it was
used in development of the SWMP, such as for BMP design.
e) It is necessary to include the percentage of existing vegetative ground cover in order to determine, after construction, when
the site has been finally stabilized. See Part I.C.4 of the Stormwater Construction Permit (also Section C.5 of this
document), for final stabilization criteria. Final stabilization of the site is necessary before coverage under the Stormwater
Construction Permit can be terminated.
f) Describe all materials and activities at the site that may have an impact on stormwater. These may include such things as:
ground disturbing activities; equipment or vehicle washing; fertilizers, chemicals, or other materials storage; vehicle
maintenance or fueling; waste incineration, treatment, storage or disposal; haul roads; off-site vehicle tracking;
loading/unloading areas, etc.
g) Will there be any discharge from the project site during construction that is not from stormwater? If so, describe the
source and how it will be handled.
h) The receiving water information is also required in the permit application. For example, "runoff from the east side of the
site will go to a roadside ditch which discharges to Jimmy Smith Gulch; runoff from the west side of the site will go to an
unnamed tributary to Westerly Creek."
Water Quality Control Division – Stormwater Program www.cdphe.state.co.us/wq/permitsunit
Appendix A - Page 6 of 20 Revised 6/2011
C.3 SWMP CONTENTS – Site Map
Permit
Part I.C.2 Stormwater Management Plan (SWMP) – Contents: Site Map
The SWMP shall include a legible site map(s), showing the entire site, identifying:
a) construction site boundaries;
b) all areas of ground surface disturbance;
c) areas of cut and fill;
d) areas used for storage of building materials, equipment, soil, or waste;
e) locations of dedicated asphalt or concrete batch plants;
f) locations of all structural BMPs;
g) locations of non-structural BMPs as applicable; and
h) locations of springs, streams, wetlands and other surface waters.
A site map must be developed for each construction project. The site map must show those items listed above. It does not
need to be drawn to scale, but it should be legible and easy to read. Maps that are part of the construction plans, such as a
grading plan, are a good base for developing the site map, if they are amended to include all required information as discussed
below. Local municipalities may also have maps suitable as bases to begin mapping procedures. If no other suitable base
maps are available, one must be developed. Regardless of the source of the base map, the site map needs to be of suitable
scale to show the construction portion of the site and the features within it.
Using Construction Plans, Plans Developed to Meet Local Stormwater Requirements, or Other Plans:
In many cases, some of the information required for the SWMP will also be included in items such as construction plans,
documents developed for a local stormwater program, material management plans, etc. These materials may be used to
meet the SWMP requirements, if they are amended and/or supplemented to include all required information. If the
SWMP will be incorporated into the construction plan, all of the required narrative information must also be included in
the plans, or developed as a separate document. If a separate document is used for some of the information not in the
construction plans, or if the information will be included in several locations, the permittee must still be able to provide
all required components of the SWMP to a State or EPA inspector. If this approach is used, it is highly recommended
that an index be provided that references the location(s) of all information required for the SWMP.
In addition to the items specifically mentioned in the permit, above, it is useful to also indicate on the map the following:
Drainage basins for each outfall – Field inspection can usually accomplish this task with acceptable accuracy. Look for
high areas such as crests of hills, parking lots, roads, etc., which would form the division between drainages. Gullies and
swales are indicators of stormwater flow direction. Obviously, if runoff is observed during a storm, most uncertainties can
be eliminated. The drainage areas shown should include the portions of the site where the activities described in I.C.1.f of
the Stormwater Construction Permit (see the permit language in Section C.2, above) occur, as well as those portions (such
as upslope areas) contributing stormwater that mixes with runoff from the construction area.
Surface water bodies – Mark on the site map any surface water bodies, including dry water courses, lakes, streams,
springs, wetlands, detention ponds, roadside or irrigation ditches, etc. These do not necessarily need to be within the
construction portion of the site, but may be adjacent to it or impacted by stormwater runoff. Also include any existing
storm sewers.
Existing and planned structural stormwater pollution control measures – Show on the map the location of any structural
stormwater pollution control measures, such as detention ponds, diversion ditches, covered material storage areas, fuel
farm secondary containment structures, etc. Refer to the guidance on how to ―Document Selected BMPs in the SWMP‖ in
Section C.4, below.
Areas where construction activities take place – for those construction activities identified in Part I.C.1.a of the
Stormwater Construction Permit (see the permit language in Section C.2, above).
In addition, other features could be included to make the SWMP a more comprehensive and usable plan. For example, a later
section of the SWMP includes requirements for material handling and spill prevention procedures, which could include a site
Water Quality Control Division – Stormwater Program www.cdphe.state.co.us/wq/permitsunit
Appendix A - Page 7 of 20 Revised 6/2011
map showing where materials are stored. By including materials handling, loading and storage areas on the site map, all
information would be in one place on a single base map. Also, including such items as site entrance(s), vehicle parking areas
and direction of stormwater flow on the site map adds to its overall utility
.
Refer to Section D of this guidance for sources of sample maps, such as the Douglas County Grading, Erosion, and Sediment
Control (GESC) Manual and the Construction Industry Compliance Assistance Center.
C.4 SWMP CONTENTS – Stormwater Management Controls
Permit
Part I.C.3 Stormwater Management Plan (SWMP) – Contents: Stormwater Management Controls
The SWMP must include a description of all stormwater management controls that will be implemented as part of the
construction activity to control pollutants in stormwater discharges. The appropriateness and priorities of stormwater
management controls in the SWMP shall reflect the potential pollutant sources identified at the facility.
The description of stormwater management controls shall address the following components, at a minimum:
This is the key part of the SWMP – a narrative description of the appropriate stormwater management controls for the
permitted site. As further addressed below, in many cases it may be necessary to supplement the narrative description with
technical drawings in order to accurately communicate the design standards for certain structural BMPs.
Permit
Part I.C.3 Stormwater Management Plan (SWMP) – Contents: SWMP Administrator
a) SWMP Administrator - The SWMP shall identify a specific individual(s), position or title who is responsible for
developing, implementing, maintaining, and revising the SWMP. The activities and responsibilities of the
administrator shall address all aspects of the facility’s SWMP.
a. SWMP Administrator: The SWMP Administrator can be an individual(s), position or title – this entity is responsible
for developing, implementing, maintaining, and revising the SWMP. Remember that the SWMP Administrator is the
contact for all SWMP-related issues and is the person responsible for its accuracy, completeness, and implementation.
Therefore, the SWMP Administrator should be a person with authority to adequately manage and direct day-to-day
stormwater quality management activities at the site.
Water Quality Control Division – Stormwater Program www.cdphe.state.co.us/wq/permitsunit
Appendix A - Page 8 of 20 Revised 6/2011
Permit
Part I.C.3 Stormwater Management Plan (SWMP) – Contents: Identification of Potential Pollutant Sources
b) Identification of Potential Pollutant Sources - All potential pollutant sources, including materials and activities, at a
site must be evaluated for the potential to contribute pollutants to stormwater discharges. The SWMP shall identify
and describe those sources determined to have the potential to contribute pollutants to stormwater discharges, and
the sources must be controlled through BMP selection and implementation, as required in paragraph (c), below.
At a minimum, each of the following sources and activities shall be evaluated for the potential to contribute
pollutants to stormwater discharges, and identified in the SWMP if found to have such potential:
1) all disturbed and stored soils;
2) vehicle tracking of sediments;
3) management of contaminated soils;
4) loading and unloading operations;
5) outdoor storage activities (building materials, fertilizers, chemicals, etc.);
6) vehicle and equipment maintenance and fueling;
7) significant dust or particulate generating processes;
8) routine maintenance activities involving fertilizers, pesticides, detergents, fuels, solvents, oils, etc.;
9) on-site waste management practices (waste piles, liquid wastes, dumpsters, etc.);
10) concrete truck/equipment washing, including the concrete truck chute and associated fixtures and equipment;
11) dedicated asphalt and concrete batch plants;
12) non-industrial waste sources such as worker trash and portable toilets; and
13) other areas or procedures where potential spills can occur.
b. Identification of Potential Pollutant Sources: The first thing to do is evaluate all pollutant sources and activities at
the site for the potential to contribute pollutants to stormwater discharges. Part I.C.3.b of the Stormwater Construction
Permit (see permit language above) lists 13 pollutant sources that must be evaluated for the reasonable potential to
contribute pollutants to runoff. During the evaluation, consider the following types of conditions that might affect the
potential for a pollutant source to contribute pollutants to stormwater:
the frequency of the activity (i.e., does it occur every day, or just once a month; can it be scheduled to occur only
during dry weather?);
characteristics of the area where the activity takes place, e.g., area, surface type (pavement, gravel, vegetation, etc.),
and physical characteristics such as site gradients and slope lengths;
ability of primary and secondary containment (fuel tanks, drum storage, etc.) at product storage and loading/unloading
facilities to prevent and contain spills and leaks;
proximity of product storage and loading/unloading facilities to waterways or drainage facilities;
concentration and toxicity of materials which may to be found in the site's stormwater runoff
contamination of storage facilities/containment with stored materials (e.g., used oil drums or tanks coated with spilled
oil)
Each pollutant source recognized through this process as having the potential to contribute pollutants to stormwater, must
be identified in the SWMP along with the specific stormwater management control (BMPs) that will be implemented to
adequately control the source. Note: the actual evaluation of the potential pollutant sources does NOT need to be
included in the SWMP – just the resultant pollutant sources and their associated BMPs.
Water Quality Control Division – Stormwater Program www.cdphe.state.co.us/wq/permitsunit
Appendix A - Page 9 of 20 Revised 6/2011
Permit
Part I.C.3 Stormwater Management Plan (SWMP) –
c) Best Management Practices (BMPs) for Stormwater Pollution Prevention - The SWMP shall identify and describe
appropriate BMPs, including, but not limited to, those required by paragraphs 1 through 8 below, that will be
implemented at the facility to reduce the potential of the sources identified in Part I.C.3.b to contribute pollutants to
stormwater discharges. The SWMP shall clearly describe the installation and implementation specifications for each
BMP identified in the SWMP to ensure proper implementation, operation and maintenance of the BMP.
1) Structural Practices for Erosion and Sediment Control. The SWMP shall clearly describe and locate all
structural practices implemented at the site to minimize erosion and sediment transport. Practices may include,
but are not limited to: straw bales, wattles/sediment control logs, silt fences, earth dikes, drainage swales,
sediment traps, subsurface drains, pipe slope drains, inlet protection, outlet protection, gabions, and temporary
or permanent sediment basins.
2) Non-Structural Practices for Erosion and Sediment Control. The SWMP shall clearly describe and locate, as
applicable, all non-structural practices implemented at the site to minimize erosion and sediment transport.
Description must include interim and permanent stabilization practices, and site-specific scheduling for
implementation of the practices. The SWMP should include practices to ensure that existing vegetation is
preserved where possible. Non-structural practices may include, but are not limited to: temporary vegetation,
permanent vegetation, mulching, geotextiles, sod stabilization, slope roughening, vegetative buffer strips,
protection of trees, and preservation of mature vegetation.
3) Phased BMP Implementation. The SWMP shall clearly describe the relationship between the phases of
construction, and the implementation and maintenance of both structural and non-structural stormwater
management controls. The SWMP must identify the stormwater management controls to be implemented during
the project phases, which can include, but are not limited to, clearing and grubbing; road construction; utility
and infrastructure installation; vertical construction; final grading; and final stabilization.
4) Materials Handling and Spill Prevention. The SWMP shall clearly describe and locate all practices implemented
at the site to minimize impacts from procedures or significant materials (see definitions at Part I.E.) that could
contribute pollutants to runoff. Such procedures or significant materials could include: exposed storage of
building materials; paints and solvents; fertilizers or chemicals; waste material; and equipment maintenance or
fueling procedures.
Areas or procedures where potential spills can occur must have spill prevention and response procedures
identified in the SWMP.
5) Dedicated Concrete or Asphalt Batch Plants. The SWMP shall clearly describe and locate all practices
implemented at the site to control stormwater pollution from dedicated concrete batch plants or dedicated
asphalt batch plants covered by this certification.
6) Vehicle Tracking Control. The SWMP shall clearly describe and locate all practices implemented at the site to
control potential sediment discharges from vehicle tracking. Practices must be implemented for all areas of
potential vehicle tracking, and can include: minimizing site access; street sweeping or scraping; tracking pads;
graveled parking areas; requiring that vehicles stay on paved areas on-site; wash racks; contractor education;
and/or sediment control BMPs, etc.
Water Quality Control Division – Stormwater Program www.cdphe.state.co.us/wq/permitsunit
Appendix A - Page 10 of 20 Revised 6/2011
Permit
Part I.C.3 Stormwater Management Plan (SWMP) –
7) Waste Management and Disposal, Including Concrete Washout.
i) The SWMP shall clearly describe and locate the practices implemented at the site to control stormwater
pollution from all construction site wastes (liquid and solid), including concrete washout activities.
ii) The practices used for concrete washout must ensure that these activities do not result in the contribution
of pollutants associated with the washing activity to stormwater runoff.
iii) Part I.D.3.c of the permit authorizes the conditional discharge of concrete washout water to the ground.
The SWMP shall clearly describe and locate the practices to be used that will ensure that no washout
water from concrete washout activities is discharged from the site as surface runoff or to surface waters.
8) Groundwater and Stormwater Dewatering.
i) The SWMP shall clearly describe and locate the practices implemented at the site to control stormwater
pollution from the dewatering of groundwater or stormwater from excavations, wells, etc.
ii) Part I.D.3.d of the permit authorizes the conditional discharge of construction dewatering to the ground.
For any construction dewatering of groundwater not authorized under a separate CDPS discharge permit,
the SWMP shall clearly describe and locate the practices to be used that will ensure that no groundwater
from construction dewatering is discharged from the site as surface runoff or to surface waters.
.
c. Best Management Practices (BMPs) for Stormwater Pollution Prevention
i) Selecting and locating appropriate BMPs: When selecting BMPs, consider first those that limit the source of the
pollutant. It is much more efficient, from both a cost and environmental standpoint, to prevent the pollution in the first
place than to clean up polluted stormwater. For example, mulching disturbed ground to reduce erosion, in most cases,
is easier and more effective than trying to capture and treat sediment-laden runoff before it reaches State waters.
ii) Specific BMPs for Material Handling and Spill Prevention: Where materials can impact stormwater runoff,
existing and planned practices that reduce the potential for pollution must be described. For example, materials
should be stored and handled in covered areas to prevent contact with stormwater, and chemicals should be stored
within berms or other secondary containment devices to prevent leaks and spills from contacting stormwater runoff.
In general, spill prevention and response procedures should include the following:
notification procedures to be used in the event of an accident. At the very least, the SWMP Administrator should
be notified. Depending on the nature of the spill and the material involved, the Colorado Department of Public
Health and Environment (24-hour spill reporting line – 877-518-5608), downstream water users, or other agencies
may also need to be notified;
instructions for clean-up procedures, and identification of spill kit location(s);
provisions for absorbents to be made available for use in fuel areas, and for containers to be available for used
absorbents; and
procedures for properly washing out concrete truck chutes and other equipment in a manner and location so that
the materials and wash water can not discharge from the site, and never into a storm drain system or stream.
Once source reduction BMPs have been evaluated, more costly options, such as mitigation of impacts or stormwater
treatment through detention storage, must be considered as necessary. The selection of BMPs is subject to the
judgment of the individual permittee, based on the conditions at the site. It is important to keep in
Water Quality Control Division – Stormwater Program www.cdphe.state.co.us/wq/permitsunit
Appendix A - Page 11 of 20 Revised 6/2011
mind that BMPs included in the SWMP and implemented at the site must be adequately designed to provide control
for all potential pollutant sources associated with construction activity to prevent pollution or degradation of State
waters. Therefore, in order to comply with your permit terms and conditions, appropriate practices must be
implemented in keeping with the pollutant(s) involved and the risk potential at the facility. Redundant BMP use is
highly recommended to eliminate reliance on any one (or two) BMPs, and is often necessary to provide an adequate
treatment train to remove pollutants in runoff.
In addition, the BMPs selected for use must be appropriately designed and implemented, following good engineering
practices. It is best to base BMP design and implementation on professionally accepted references. Many well-
accepted references are available that include guidance on proper BMP selection, design, and implementation. Some
counties, cities, and local agencies have adopted criteria manuals for stormwater BMPs. Section D.1 of this guidance
contains a discussion of additional resources for more in-depth information on stormwater quality BMPs.
BMP location
A permittee must ensure that BMPs implemented to control stormwater pollution are located prior to the stormwater
discharge to a receiving water or a stormwater collection system. To meet this condition, BMPs may be implemented at
any location that allows for adequate treatment of stormwater pollutants, as long as all of the following criteria are met:
All BMPs are located:
o prior to the stormwater leaving the control of the permittee, i.e., where the permittee is capable of ensuring the
BMPs‘ proper operation and maintenance (see below section on Ensuring BMPs);
o prior to discharge to a receiving water defined as Waters of the United States (see below section on Protecting
Waters of the US); and
o prior to discharge into a municipal storm sewer or other stormwater collection system not owned by the
permittee (unless specific permission is granted).
BMPs are implemented to control all pollutant sources covered by the permit certification (i.e., unmanaged pollutant
sources are not located down slope from the last BMP at a site).
BMPs are implemented in accordance with the site‘s SWMP.
Although it is acceptable, and often advisable when used in conjunction with redundant BMPs, to locate structural BMPs
in areas of concentrated flow (e.g., check dams along drainage ditches, detention ponds, etc.), remember that removing
sediment from stormwater is often not as efficient a practice as preventing erosion in the first place, and that once erosion
starts, additional sediment control BMPs will almost always be necessary to prevent the discharge of sediment from the
site. The most efficient construction site BMPs are those that prevent erosion from occurring.
Ensuring BMPs are under the Control of the Permittee
If a permittee will rely on contracts or agreements with other entities to manage BMPs (e.g., when BMPs will be located
off of the permittee‘s property and implemented by a second party, such as a site developer), the guidance found in Part
G.2.b of the Stormwater Fact Sheet—Construction (available from the Division‘s web site at
www.cdphe.state.co.us/wq/PermitsUnit) must be followed to ensure the BMPs are properly addressed in the SWMP and
implemented in the field. A permittee may not rely on a BMP owned or operated by a second party if the permittee does
not have permission to use the BMP, and/or if they do not have any agreements in place to ensure its adequate operation
and maintenance in accordance with the permittee‘s SWMP.
Protecting Waters of the United States
BMPs must not be located within waterways, including wetlands, that are defined as Waters of the United States, unless
specifically authorized by and in compliance with a separate 404 permit (also referred to as Dredge and Fill permits)
from the U.S. Army Corps of Engineers. Even when BMPs may be authorized in natural waterways, such BMPs are
only intended to control pollutants originating from activities within the waterway, and additional BMPs are still
necessary to prevent sediment from the remainder of the site from entering that waterway. Note that even if a drainage
has been modified by a private or municipal entity, it still may be considered Waters of the United States. It is the owner
and/or operator‘s responsibility, through consultation with the Army Corps of Engineers, to confirm the existence of any
Waters of the United States at their site. More information on 404 permitting, including regional office contact
information, may be obtained from the Army Corps of Engineers regulatory programs‘ web page at
Water Quality Control Division – Stormwater Program www.cdphe.state.co.us/wq/permitsunit
Appendix A - Page 12 of 20 Revised 6/2011
http://www.usace.army.mil/inet/functions/cw/cecwo/reg/, or by calling the Denver Regulatory Office at (303) 979-4120.
iii) Documenting Selected BMPs in the SWMP (including phasing of BMP implementation): The SWMP must
describe the specific stormwater management controls (BMPs) that will be implemented at the site to adequately
control each identified pollutant source (see Section C.4.b, above). Estimated dates for BMP implementation and
maintenance are required, and any existing controls must also be discussed. The plan shall identify both structural and
non-structural control measures that are necessary for erosion and sediment control at the site. Thoroughly describe
how the BMP used at the site will change with the different stages of construction activity at the site, and make sure
that BMPs implemented for dedicated concrete or asphalt batch plants, if applicable, and vehicle tracking controls, are
clearly documented.
BMP description: Level of detail
BMP descriptions provided in the SWMP must contain adequate detail to ensure proper implementation at the site. The
following information must be addressed in the SWMP:
What BMPs will be implemented?
When will the BMPs be implemented? Many BMPs will only be implemented during specific phases of the project.
For example, silt fence and detention ponds may be installed prior to grading, while inlet protection for a newly
constructed stormwater collection system will need to be installed upon completion of the inlets.
Where will the BMPs be implemented? The SWMP must clearly indicate the locations where BMPs will be
implemented. For structural BMPs, this will usually require including the locations on the site map discussed in
Section C.3 above.
How will the BMPs be implemented? The installation and implementation specifications included in the SWMP
must be sufficient to ensure proper implementation, including procedures for operation and maintenance of the
BMP. For structural BMPs, in most cases this must include a technical drawing. For example, if silt fence will be
used at a site, in addition to the timing and location of installation, the SWMP must provide information such as
trenching depth, stake spacing, materials, etc. BMP installation and implementation criteria must follow good
engineering practices. Although it is not necessary to include design calculations in the SWMP, such as those used
to determine pond capacity or slope limitations for silt fence, this information may be useful to include to assist in
proper revisions to the SWMP and site BMPs if and when necessary, as discussed below.
iv) Non-Stormwater Discharges: Except for emergency fire fighting activities, landscape irrigation return flow,
uncontaminated springs, construction dewatering and concrete wash out water, the Stormwater Construction Permit
only covers discharges composed entirely of stormwater.
Concrete Washout water can NOT be discharged to surface waters or to storm sewer systems without separate
permit coverage. The discharge of Concrete Washout water to the ground, under specific conditions, may be allowed
by the Stormwater Construction Permit when appropriate BMPs are implemented. Additional information on this
subject is available in the Stormwater Fact Sheet – Construction, available from the Division‘s web site at
www.cdphe.state.co.us/wq/PermitsUnit.
Construction Dewatering water can NOT be discharged to surface waters or to storm sewer systems without
separate permit coverage. The discharge of Construction Dewatering water to the ground, under specific conditions,
may be allowed by the Stormwater Construction Permit when appropriate BMPs are implemented. Additional
information on this subject is available in the Stormwater Fact Sheet – Construction, available from the Division‘s
web site at www.cdphe.state.co.us/wq/PermitsUnit.
Water Quality Control Division – Stormwater Program www.cdphe.state.co.us/wq/permitsunit
Appendix A - Page 13 of 20 Revised 6/2011
Aside from the exceptions noted above, non-stormwater discharges must be addressed in a separate permit issued for
that discharge. Contact the Division or visit our web page at www.cdphe.state.co.us/wq/PermitsUnit for guidance and
applications.
v) Stormwater Dewatering: The discharge of pumped stormwater, only, from excavations, ponds, depressions, etc.,
to surface waters, or to a municipal separate storm-sewer system (MS4) is allowed by the Stormwater Construction
Permit, as long as the dewatering activity and associated BMPs are identified in the SWMP (including location of the
activity), and BMPs are implemented in accordance with the SWMP.
Note: Pumping stormwater does not by itself render the pumped water a process water, provided that the pump does
not contribute additional pollutants to the discharge. If, however, a sheen is visible on the water leaving the pump, a
separate discharge permit is required.
d. Revising BMPs and the SWMP: At nearly every site, the implemented BMPs will have to be modified to adapt to
changing site conditions, or to ensure that potential pollutants are consistently and properly managed. The pollutant
sources and management practices at a site must be reviewed on an ongoing basis (and specifically during the required
inspections listed in Part I.D.6 of the Stormwater Construction Permit and discussed below). When BMPs or other site
conditions change, the SWMP must be modified to accurately reflect the actual field conditions. Examples include,
but are not limited to, removal of BMPs, identification of new potential pollutant sources, addition of BMPs, modification
of BMP installation and implementation criteria or maintenance procedures, and changes in items included in the site map
and/or description. SWMP revisions must be made prior to changes in site conditions, except for Responsive SWMP
Changes, as follows:
– SWMP revisions must be made immediately after changes are made in the field to address BMP installation
and/or implementation issues; or
– SWMP revisions must be made as soon as practicable, but in no case more than 72 hours, after change(s) in
BMP installation and/or implementation occur at the site that require development of materials to modify the
SWMP (e.g., design of retention pond capacity)
The SWMP should be viewed as a ―living document‖ that is continuously being reviewed and modified as part of the
overall process of assessing and managing stormwater quality issues at the site. The following illustration summarizes the
process of evaluating, selecting, documenting, implementing, and revising BMPs.
Evaluate Pollutant Sources
Select BMPs
Document BMPs
Implement BMPs
Water Quality Control Division – Stormwater Program www.cdphe.state.co.us/wq/permitsunit
Appendix A - Page 14 of 20 Revised 6/2011
C.5 SWMP CONTENTS – Final Stabilization and Long-term Stormwater Management
Permit
Part I.C.4 Stormwater Management Plan (SWMP) – Contents: Final Stabilization and Long-term Stormwater
Management
a) The SWMP shall clearly describe the practices used to achieve final stabilization of all disturbed areas at the site, and
any planned practices to control pollutants in stormwater discharges that will occur after construction operations
have been completed at the site.
b) Final stabilization practices for obtaining a vegetative cover should include, as appropriate: seed mix selection and
application methods; soil preparation and amendments; soil stabilization practices (e.g., crimped straw, hydro mulch
or rolled erosion control products); and appropriate sediment control BMPs as needed until final stabilization is
achieved; etc.
c) Final stabilization is reached when all ground surface disturbing activities at the site have been completed, and
uniform vegetative cover has been established with an individual plant density of at least 70 percent of pre-
disturbance levels, or equivalent permanent, physical erosion reduction methods have been employed.
The Division may, after consultation with the permittee and upon good cause, amend the final stabilization criteria in this
section for specific operations.
Typically, the stormwater discharges associated with construction activity are eliminated when the site is finally stabilized. As
soon as practicable after construction activities have been completed in a disturbed area, permanent stabilization should be
started to prevent further erosion of soil from that area. All disturbed areas (except those portions covered by pavement or a
structure) must be finally stabilized once all construction activities are completed in order to inactivate the permit coverage.
Sediment that collects within the site's drainage system and permanent water quality or quantity controls is also considered
unstabilized soil, and must be removed prior to the site being considered finally stabilized.
The SWMP must include a description of what measures will be taken to finally stabilize the site. The method of stabilization
must be provided for all areas that will remain pervious (i.e., vegetated or landscaped instead of paved, built on, or otherwise
structurally stabilized). Questions that may need to be addressed include: What type of cover will be used? What are the
specific seed mixtures and application rates? Are additional BMPs needed to prevent erosion as the vegetation becomes
established? Will the soil need to be amended? Will special methods be employed on any steep slopes or areas of
concentrated flow?
Inactivation of permit coverage
Coverage under the Stormwater Construction Permit may be inactivated by the permittee when the site has attained final
stabilization, all temporary erosion and sediment control measures have been removed, and all components of the
SWMP are complete.
Any planned stormwater management controls to prevent or control pollution of stormwater after construction is completed
must be addressed here. They typically include retention or detention ponds, infiltration measures, vegetative swales, and
natural depressions.
New developments, buildings, etc., will often incorporate elements of permanent stormwater quality control into their design.
The SWMP must be prepared consistent with these structural and nonstructural controls. Where possible, permanent
stormwater quality controls can be constructed at the initial stages of construction, or modified at the end of construction. This
can increase the efficiency of the controls by using them during both the building and operational phases of the project. When
a permanent structural control is initially used as a construction BMP, the SWMP must contain the necessary information
discussed in the guidance for documenting BMPs, Section C.4 above.
Water Quality Control Division – Stormwater Program www.cdphe.state.co.us/wq/permitsunit
Appendix A - Page 15 of 20 Revised 6/2011
Use of Permanent Detention Ponds as BMPs during Construction
Permanent detention ponds are allowed to be used as a temporary construction BMP, if: a) the pond is clearly designated
as a construction BMP in the SWMP; b) detention pond inspection and maintenance are described as required in Part
I.B.2, Part I.C.3, and Parts I.D.6, 7, and 8 of the Stormwater Construction Permit; and c) the pond is designed and
implemented for use as a BMP during construction in accordance with good engineering, hydrologic and pollution
control practices. In addition, stormwater discharges from the pond must not cause or threaten to cause pollution or
degradation of State waters. When a permanent detention pond is used in this manner, redundant upgradient erosion and
sediment control BMPs are still necessary in almost all cases to comply with the permit requirements to select and design
BMPs to prevent pollution or degradation of State waters.
The design and implementation of the pond may differ from what will exist upon completion of the project when the
BMP becomes a permanent water quality feature. In this case, the description of the BMP included in the SWMP must
address these differences. For example, if the outfall will be modified during construction to provide additional filtering
or settling of sediment (which may or may not be necessary, depending on the existence of upstream BMPs, sediment
loading to the pond, final outlet design, etc.), those modifications must be included in the SWMP. If additional
temporary stabilization of the pond (e.g., at points of concentrated flow into or through the pond, unstable slopes, etc.) is
needed to prevent erosion and transport of sediment from the pond during construction, this must also be addressed.
Prior to inactivation of the permit, the pond must be stabilized in accordance with the permit requirements and sediment
removed from the site‘s drainage system. Although not related to compliance with the construction stormwater permit,
the pond may need to be inspected and modified following construction in order to meet local permanent BMP design
criteria.
C.6 SWMP CONTENTS – Inspection and Maintenance Procedures
Permit
Part I.C.5. Stormwater Management Plan (SWMP) – Contents: - Inspection and Maintenance
Part I.D.6 of the permit includes requirements for site inspections. Part I.D.7 of the permit includes requirements for BMP
maintenance. The SWMP shall clearly describe the inspection and maintenance procedures implemented at the site to
maintain all erosion and sediment control practices and other protective practices identified in the SWMP, in good and
effective operating condition.
a. Inspection Schedules: The minimum inspection schedule described in Part I.C.6.a of the Stormwater Construction
Permit requires that a thorough inspection of the stormwater management system be performed and documented at least
every 14 days, and within 24 hours of any precipitation or snowmelt event that causes surface erosion (i.e., that results in
stormwater running across the ground). If more frequent inspections are required to ensure that BMPs are properly
maintained and operated, the inspection schedule must be modified to meet this need.
Exceptions to the minimum inspection schedule are also provided. Any use of an exception is temporary, and does not
eliminate the requirement to perform routine maintenance due to the effects of a storm event or other conditions that may
impact BMP performance, including maintaining vehicle tracking controls and removing sediment from impervious areas.
Additionally, this part of the SWMP must also include maintenance procedures for the BMPs, as discussed below. You
will need to set up a schedule appropriate to the activity and the BMP. Preventive maintenance should be coupled with
periodic inspections.
b. Inspection Procedures: The inspection must include observation of:
the construction site perimeter and discharge points (including discharges into a storm sewer system);
all disturbed areas;
areas used for material/waste storage that are exposed to precipitation;
Water Quality Control Division – Stormwater Program www.cdphe.state.co.us/wq/permitsunit
Appendix A - Page 16 of 20 Revised 6/2011
other areas determined to have a significant potential for stormwater pollution, such as demolition areas or concrete
washout locations, or locations where vehicles enter or leave the site;
erosion and sediment control measures identified in the SWMP; and
any other structural BMPs that may require maintenance, such as secondary containment around fuel tanks, or the
condition of spill response kits.
The inspection must determine if there is evidence of, or the potential for, pollutants entering the drainage system. BMPs
should be reviewed to determine if they still meet the design and operational criteria in the SWMP, and if they continue to
adequately control pollutants at the site. Any BMPs not operating in accordance with the SWMP must be addressed as
soon as possible, immediately in most cases, to minimize the discharge of pollutants, and the SWMP must be updated as
described in Section C.4.e, above. Inspections must be documented as discussed in the Record Keeping section, below.
c. BMP Maintenance/Replacement and Failed BMPs: The Stormwater Construction Permit requires that all erosion
and sediment control practices and other protective measures identified in the SWMP be maintained in effective operating
condition and in accordance with good engineering, hydrologic and pollution control practices. Therefore, site inspection
procedures must address maintenance of BMPs that are found to no longer function as needed and designed, as well as
preventive maintenance to proactively ensure continued operation (e.g., removing collected sediment outside the
acceptable tolerances of the BMP).
A preventive maintenance program should prevent BMP breakdowns and failures by proactively maintaining or replacing
BMPs and equipment. Site inspections should uncover any conditions, such as deteriorating silt fence or water collected
in fuel tank secondary containment, which could result in the discharge of pollutants to storm sewers and surface waters.
For example, sediment that has been collected by sediment controls, such as silt fence and inlet protection, should be
removed on a regular basis, to prevent failure of BMPs, and remove the potential of that sediment from being discharged
from the site if the BMP did fail. Removed sediment must be moved to an appropriate location where it will not become
an additional pollutant source, and should never be placed in ditches or streams. Maintenance activities to correct
problems noted during inspections must be documented as discussed in the Record Keeping section, below.
The inspection process must also include procedures to ensure that, when needed, BMPs are replaced or new BMPs added
to adequately manage the pollutant sources at the site. This procedure is part of the ongoing process of revising the BMPs
and the SWMP as discussed Section C.4, above, and any changes to BMPs must be recorded in the SWMP. The SWMP
must be modified as appropriate as soon as practicable after such inspections.
BMPs that have failed, or have the potential to fail without maintenance or modifications, must be addressed as soon as
possible, immediately in most cases, to prevent the discharge of pollutants.
d. Record Keeping and Documenting Inspections: Keeping accurate and complete records serves several functions.
First, keeping records of spills, leaks, inspections, etc. is a requirement of the Stormwater Construction Permit; therefore,
enforcement action, including fines, could result if records are not adequate. Second, by keeping accurate and detailed
records, you will have documentation of events which could prove invaluable should complications arise concerning the
permit, lawsuits, etc.
The permittee must document inspection results and maintain a record of the results for a period of 3 years following
expiration or inactivation of permit coverage. These records must be made available to the Division or EPA upon request.
The following items must be documented as part of the site inspections:
i) The inspection date;
ii) Name(s) and title(s) of personnel making the inspection;
iii) Location(s) of discharges of sediment or other pollutants from the site;
iv) Location(s) of BMPs that need to be maintained;
v) Location(s) of BMPs that failed to operate as designed or proved inadequate for a particular location;
vi) Location(s) where additional BMPs are needed that were not in place at the time of inspection;
vii) Deviations from the minimum inspection schedule as provided in Section C.6.a above;
viii) Description of corrective action for items iii, iv, v, and vi, above, dates corrective action(s) taken, and measures
Water Quality Control Division – Stormwater Program www.cdphe.state.co.us/wq/permitsunit
Appendix A - Page 17 of 20 Revised 6/2011
taken to prevent future violations, including requisite changes to the SWMP, as necessary; and
ix) After adequate corrective action(s) has been taken, or where a report does not identify any incidents requiring
corrective action, the report shall contain a signed statement indicating the site is in compliance with the permit to
the best of the signer‘s knowledge and belief.
In addition to inspection records, the permittee may opt to keep a log book for use in tracking other items related to the
SWMP such as those listed below. Additional information such as dated photographs, field notebooks, drawings and
maps, and the items below, etc. can also be included where appropriate.
BMP operation and maintenance
stormwater contamination
contacts with suppliers
notes on the need for and performance of preventive maintenance and other repairs
implementation of specific items in the SWMP
training events (given or attended)
events involving materials handling and storage
contacts with regulatory agencies and personnel
notes of employee activities, contact, notifications, etc.
Records of spills, leaks, or overflows that result in the discharge of pollutants must be documented and maintained. You
may also want to record other spills that are responded to, even if they do not result in a discharge of pollutants.
Information that should be recorded for all occurrences includes the time and date, weather conditions, reasons for the
spill, etc. Some spills may need to be reported to the Division immediately. Specifically, a release of any chemical, oil,
petroleum product, sewage, etc., which may enter waters of the State of Colorado (which include surface water, ground
water and dry gullies or storm sewers leading to surface water) must be reported. More guidance is available on the web at
www.cdphe.state.co.us/hm/spillsandreleases.htm. The Division‘s toll-free 24-hour number for environmental hazards and
chemical spills and releases is 1-877-518-5608.
D. ADDITIONAL SWMP AND BMP RESOURCES
There are a multitude of resources available to the construction industry to assist in complying with the requirements of the
Stormwater Construction Permit. The following suggested list of resources can provide valuable tools to assist you in
developing and implementing your SWMP as effectively and efficiently as possible. However, the guidance found in the
resources listed below in no way replaces the requirements of the Stormwater Construction Permit, as described in Sections A
through C, above. Therefore, when using the following resources, especially in the case of example plans and maps, it is
essential that you ensure that all of the requirements included in this guidance document and the Stormwater
Construction Permit are being met.
Many of the resources below require access to the internet. If you are unable to obtain any resources you need due to a lack of
access to the internet, please contact the Division at (303) 692-3517 and we can try to assist you in obtaining the information
you need.
D.1. RESOURCES – BMP Design and Implementation
a. BMP Design Criteria Manuals:
Be sure to check with the local city or county to determine if they require that specific design criteria be met. The
following are some highly respected criteria manuals that can be used in designing and implementing BMPs for your site.
Water Quality Control Division – Stormwater Program www.cdphe.state.co.us/wq/permitsunit
Appendix A - Page 18 of 20 Revised 6/2011
Urban Drainage and Flood Control District
Urban Storm Drainage Criteria Manual Volume 3 – Best Management Practices
o This criteria manual is commonly used by cities and counties in the Denver metropolitan area. The
manual includes discussion of stormwater quality management and BMPs for many activities, including
construction.
This manual is a highly respected across the country and a great resource for professionally accepted
design criteria for construction BMPs.
Available free from the ―download‖ section of the Urban Drainage and Flood Control District
web page:
http://www.udfcd.org/
Douglas County
Grading, Erosion, and Sediment Control (GESC) Manual
o The criteria manual for compliance with Douglas County‘s GESC permitting program for stormwater
quality. Includes an excellent discussion of effective stormwater management strategies, design criteria,
and several very useful sample site maps.
Available for download free from the Douglas County Public Works web page:
http://www.douglas.co.us/publicworks/engineering/GESC.html
Also available in print or CD-ROM from the Engineering Division office:
Douglas County Public Works Department - Engineering Division
100 Third Street
Castle Rock, CO 80104
Phone: 303-660-7490
b. General BMP Selection and Design Guidance
Colorado Department of Transportation
Erosion Control and Stormwater Quality Guide
o Guidance on BMP selection and design applicable specifically to highway development projects, but also
useful as general guidance.
Available online from CDOT‘s MS4 Program web page at:
http://www.dot.state.co.us/environmental/envWaterQual/wqms4.asp
EPA Menu of BMPs
Construction Site Storm Water Runoff Control
o EPA guidance for cities and counties who are required to develop programs to regulate construction
activities in their jurisdiction. The BMP fact sheets provide a good discussion of various structural and
nonstructural BMPs.
Available online at: http://cfpub.epa.gov/npdes/stormwater/menuofbmps/index.cfm
International Stormwater Best Management Practices (BMP) Database
o Database of monitoring results showing effectiveness of structural and non-structural BMPs. Currently,
the database and web site do not include much analysis of the data; this will be added in the future. Data
contributions are being solicited on an ongoing basis.
Available online at:
http://www.bmpdatabase.org
c. Special Applications
Burn Areas:
U.S. Department of Agriculture, Forest Service, 2006. Burned Area Emergency Response Treatments Catalog.
0625 1801—SDTDC.
Water Quality Control Division – Stormwater Program www.cdphe.state.co.us/wq/permitsunit
Appendix A - Page 19 of 20 Revised 6/2011
Available online at: http://www.fs.fed.us/eng/pubs/pdf/BAERCAT/lo_res/TOContents.pdf
Soil Bioengineering:
U.S. Department of Agriculture, Forest Service, 2000. Soil Bioengineering An Alternative for Roadside
Management. 0077 1801—SDTDC.
Available online at:
http://ttap.colostate.edu/Library/MISC/USDA%200077%201801%20SDTDC.pdf
Franti, Thomas G. 2006. Bioengineering for Hillslope, Streambank and Lakeshore Erosion Control. University of
Nebraska–Lincoln Extension.
Available online at: http://www.ianrpubs.unl.edu/epublic/live/g1307/build/g1307.pdf
D.2. RESOURCES – Example Management Plans
Construction Industry Compliance Assistance Center - Stormwater Pollution Prevention Plans
o A website with examples of actual stormwater plans prepared for a range of construction projects located in
various states. ―The purpose of presenting these documents is to demonstrate various approaches to SWPPP
development. Please note that the examples presented here should not be excerpted or used as templates in
the preparation of a SWPPP, since each SWPPP must be designed to handle the specific needs of a particular
construction site.‖ (Note that Colorado‘s plan is referred to as a ‗SWMP‘ instead of ‗SWPPP‘.) Not all of the
example plans will meet the requirements of the Colorado General Permit. Therefore, it is essential that this
SWMP/SWPPP guidance document be used to ensure your completed plan contains all of the required
elements and is appropriate for your site.
Available online at: http://www.cicacenter.org/swppp.html
D.3. RESOURCES – Training
Rocky Mountain Education Center (Located at Red Rocks Community College, Lakewood) -
Stormwater Management and Erosion Control Course
o One-day course, with an optional additional half-day in the field, on the principles and practices of erosion
and sediment control. Recommended for municipal erosion control inspectors and those practicing
erosion control in the field. This course is required for the CDOT certified erosion control supervisor
certification. Course is given at Red Rocks Community College in Lakewood. Course CETC #150.
Stormwater Compliance Inspector Course
o Two-day course (including half-day in the field) on preparing for and conducting a comprehensive
construction site inspection. Recommended for municipal erosion control inspectors, construction site
managers, and those practicing erosion control in the field. Prerequisite: Stormwater Management and
Erosion Control Course (see above). Course is given at Red Rocks Community College in Lakewood.
Course CETC #151.
Contact the Rocky Mountain Education Center at (800) 933-8394
Schedule of classes available online at: http://www.rrcc.edu/rmec/cetc.html
Keep it Clean Partnership (Boulder)
Erosion Control Training and Certification
o The Keep it Clean Partnership provides a low-cost, eight-hour erosion control training and recertification
program available for both public and private inspectors and contractors.
Contact the Keep it Clean Partnership at 303-441-1439
http://bcn.boulder.co.us/basin/kicp//kicp_construction.htm
Colorado Department of Transportation Outdoor BMP Facility (Headquarters Office – Denver)
BMP Filed Academy
Water Quality Control Division – Stormwater Program www.cdphe.state.co.us/wq/permitsunit
Appendix A - Page 20 of 20 Revised 6/2011
o The Colorado Department of Transportation (CDOT) BMP Field Academy offers all day sessions with hands-
on opportunities to install erosion and sediment control BMPs in the field and evaluate their performance
under simulated precipitation run-off conditions. The outdoor facility includes slopes with irrigation
systems and ditches fed by large water tanks, to simulate precipitation and run-off events. These training
sessions are open to non-CDOT employees and industry professionals that have completed the CDOT ECS
Certification training.
More information and registration forms: http://www.altitudeta.com/bmpacademy.htm
The Associated General Contractors (AGC), Colorado Chapter (Denver)
Uniform Stormwater Management System (USMS) Basic Stormwater Course
o One-day course, explains the background and structure of the federal, state and local construction
stormwater permitting system and requirements, defines the relationships between common construction
activities, potential pollutants generated by those activities, and the controls or best management practices
appropriate to control such pollutants. This Basic course is a Pre-requisite for the USMS Advanced
Stormwater Manager Course.
Uniform Stormwater Management System (USMS) Advanced Stormwater Manager Course
o Two-day course, teaches the use of the Uniform Stormwater Management System (USMS) approach to
permit compliance from preconstruction planning to permit termination. Course certification is required to
qualify as a Permit Compliance Manager for participants in the Colorado Stormwater Excellence Program
(CSEP). Half of the second day will be in the field. Course teaches proper documentation and inspection
methodology and provides a practical, standardized step by step approach for permit compliance including
all required processes and forms. Upon completion, students will have access to the AGC’s on-line USMS
forms and resource center.
Contact AGC Colorado, Ed Davis, at 303 388-2422 for information
Class schedule and online registration at http://www.agccolorado.org/
APPENDIX B
INACTIVATION/REASSIGNMENT/TRANSFER FORMS
For Agency Use Only
Permit Number Assigned
COR03-______________
Date Received ____/____/____
Month Day Year
NOTICE OF REASSIGNMENT OF PERMIT COVERAGE AND GENERAL PERMIT APPLICATION
STORMWATER DISCHARGE ASSOCIATED WITH CONSTRUCTION ACTIVITIES
PHOTO COPIES, FAXED COPIES, PDF COPIES OR EMAILS WILL NOT BE ACCEPTED.
Please print or type. Original signatures are required. This application must be considered complete by the Division prior to initiation
of permit processing. The Division will notify the applicant if additional information is needed to complete the application. If more space is
required to answer any question, please attach additional sheets to the application form. Applications must be mailed or delivered to:
Colorado Department of Public Health and Environment
Water Quality Control Division
4300 Cherry Creek Drive South
WQCD-P-B2
Denver, Colorado 80246-1530
**Part I of the application beginning below is to be filled out by the new permit applicant that will be assuming permitting
liability for the reassigned portion of the original applicant’s site.
**Part II of the application, starting on page 3 of the form, is to be completed by the current permittee.
Both Parts I (pages 1-4) and II (page 5) must be completed.
EXISTING CERT **__________________ (from Part II)
** NOTE: THIS WILL CREATE A NEW PERMIT FOR PART 1 APPLICANT. THE EXISTING PERMIT WILL NOT BE
TERMINATED. THIS IS NOT A TRANSFER FORM.
PART I - To be completed by the New permit applicant:
I hereby accept the reassignment of permit coverage for the area described in this application. I have reviewed the terms and
conditions of this permit and the Stormwater Management Plan and accept full responsibility, coverage and liability
REASSIGNMENT WILL BE EFFECTIVE _____________________________
MONTH/ DAY/ YEAR
Applicant is : Property Owner Contractor/Operator
A. CONTACT INFORMATION - NOT ALL CONTACT TYPES MAY APPLY * indicates required
*PERMITTEE (If more than one please add additional pages)
*ORGANIZATION FORMAL NAME:
1) *PERMITTEE the person authorized to sign and certify the permit application. This person receives all
permit correspondences and is legally responsible for compliance with the permit.
Responsible Position (Title): ___________________________________________
Currently Held By Person):___________________________________________________________
Telephone No:__________________________________ email address__________________________________
Organization:
Mailing Address:
City:_ State: Zip:
This form must be signed by the Permittee to be considered complete.
Per Regulation 61 In all cases, it shall be signed as follows:
a) In the case of corporations, by a responsible corporate officer. For the purposes of this section, the responsible
corporate officer is responsible for the overall operation of the facility from which the discharge described in the
application originates.
b) In the case of a partnership, by a general partner.
c) In the case of a sole proprietorship, by the proprietor.
d) In the case of a municipal, state, or other public facility, by either a principal executive officer or ranking elected official
Application Part 1 page 1of 4 updated 4/2011
2) DMR COGNIZANT OFFICIAL (i.e. authorized agent) the person or position authorized to sign and certify reports required by the
Division including Discharge Monitoring Reports *DMR’s, Annual Reports, Compliance Schedule submittals, and other information
requested by the Division. The Division will transmit pre-printed reports (ie. DMR’s) to this person. If more than one, please add
additional pages. Same As 1) Permittee
Responsible Position (Title):____________________________________________________
Currently Held By (Person):__________________________________________________
Telephone No:_______________________________ email address____________________________________
Organization:_______________________________________________________________
Mailing Address: ____________________________________________________________
City:_ State: Zip: _______________________
Per Regulation 61 : All reports required by permits, and other information requested by the Division shall be signed by the
permittee or by a duly authorized representative of that person. A person is a duly authorized representative only if: (i) The
authorization is made in writing by the permittee
(ii) The authorization specifies either an individual or a position having responsibility for the overall operation of the regulated
facility or activity such as the position of plant manager, operator of a well or a well field, superintendent, position of equivalent
responsibility, or an individual or position having overall responsibility for environmental matters for the company. (A duly
authorized representative may thus be either a named individual or any individual occupying a named position); and
(iii) The written authorization is submitted to the Division
3) *SITE CONTACT local contact for questions relating to the facility & discharge authorized by this permit for the facility.
Same As 1) Permittee
Responsible Position (Title):____________________________________________________
Currently Held By (Person):__________________________________________________
Telephone No:_______________________________ email address____________________________________
Organization:_______________________________________________________________
Mailing Address: ____________________________________________________________
City:_ State: Zip: _______________________
4) * BILLING CONTACT if different than the permittee
Responsible Position (Title):____________________________________________________
Currently Held By (Person):__________________________________________________
Telephone No:_______________________________ email address____________________________________
Organization:_______________________________________________________________
Mailing Address: ____________________________________________________________
City:_ State: Zip: _______________________
5) OTHER (Please describe)_____________________________________________________
Responsible Position (Title):____________________________________________________
Currently Held By (Person):__________________________________________________
Telephone No:_______________________________ email address____________________________________
Organization:_______________________________________________________________
Mailing Address: ____________________________________________________________
City:_ State: Zip: _______________________
Application Part 1 page 2 of 4 updated 4/2011
B. Permitted Project/Facility Information
Project/Facility Name
Street Address or cross streets
City, Zip Code
County
Facility Latitude/Longitude— (approximate center of site to nearest 15 seconds using one of following formats
001A Latitude . Longitude . (e.g., 39.703°, 104.933°’)
degrees (to 3 decimal places) degrees (to 3 decimal places)
or
001A Latitude º ’ " Longitude º ’ " (e.g., 39°46'11"N, 104°53'11"W)
degrees minutes seconds degrees minutes seconds
C. MAP (Attachment)
Map: Attach a map that indicates the site location and that CLEARLY shows the boundaries of the area that will
be disturbed. Maps must be no larger than 11x17 inches.
D. LEGAL DESCRIPTION
Legal description: If subdivided, provide the legal description below, or indicate that it is not applicable (do not
supply Township/Range/Section or metes and bounds description of site)
Subdivision(s): Lot(s): Block(s):
OR
□ Not applicable (site has not been subdivided)
E. AREA OF CONSTRUCTION SITE
Total area of project site (acres):
Area of project site to undergo disturbance (acres):
Total disturbed area of Larger Common Plan of Development or Sale, if applicable:
(i.e., total, including all phases, filings, lots, and infrastructure not covered by this application)
F. NATURE OF CONSTRUCTION ACTIVITY
Check the appropriate box(s) or provide a brief description that indicates the general nature of the construction
activities. (The full description of activities must be included in the Stormwater Management Plan.)
□ Single Family Residential Development
□ Multi-Family Residential Development
□ Commercial Development
□ Oil and Gas Production and/or Exploration
(including pad sites and associated infrastructure)
□ Highway/Road Development
(not including roadways associated with commercial or residential development)
□ Other, Describe:
G. ANTICIPATED CONSTRUCTION SCHEDULE
Construction Start Date: Final Stabilization Date:
Application Part 1 page 3 of 4 updated 4/2011
NOTICE OF REASSIGNMENT OF PERMIT COVERAGE AND GENERAL PERMIT APPLICATION
STORMWATER DISCHARGE ASSOCIATED WITH CONSTRUCTION ACTIVITIES
Application Part 1 page 4 of 4 updated 4/2011
H. RECEIVING WATERS
(If discharge is to a ditch or storm sewer, include the name of the ultimate receiving waters)
Immediate Receiving Water(s):
Ultimate Receiving Water(s):
I. REQUIRED SIGNATURES (Both parts i. and ii. must be signed)
Signature of Applicant: The applicant must be either the owner and/or operator of the construction site.
Refer to Part B of the instructions for additional information. The application must be signed by the
applicant to be considered complete. In all cases, it shall be signed as follows:
a) In the case of corporations, by a principal executive officer of at least the level of vice-president or
his or her duly authorized representative, if such representative is responsible for the overall
operation of the facility from which the discharge described in the application originates.
b) In the case of a partnership, by a general partner.
c) In the case of a sole proprietorship, by the proprietor.
d) In the case of a municipal, state, or other public facility, by either a principal executive officer,
ranking elected official, or other duly authorized employee if such representative is responsible for
the overall operation of the facility from which the discharge described in the form originates.
STOP!:A Stormwater Management Plan must be completed prior to signing the following certifications!
i. Stormwater Management Plan Certification
“I certify under penalty of law that a complete Stormwater Management Plan, as described in Appendix A of this
application, has been prepared for my activity. Based on my inquiry of the person or persons who manage the
system, or those persons directly responsible for gathering the information, the Stormwater Management Plan is,
to the best of my knowledge and belief, true, accurate, and complete. I am aware that there are significant
penalties for falsely certifying the completion of said SWMP, including the possibility of fine and imprisonment for
knowing violations.”
XX
Signature of Legally Responsible Person or Authorized Agent (submission must include original signature) Date Signed
Name (printed) Title
ii. Signature of Permit Legal Contact
“I certify under penalty of law that I have personally examined and am familiar with the information submitted in this
application and all attachments and that, based on my inquiry of those individuals immediately responsible for
obtaining the information, I believe that the information is true, accurate and complete. I am aware that there are
significant penalties for submitting false information, including the possibility of fine or imprisonment.
“I understand that submittal of this application is for coverage under the State of Colorado General Permit for
Stormwater Discharges Associated with Construction Activity for the entirety of the construction site/project
described and applied for, until such time as the application is amended or the certification is transferred,
inactivated, or expired.”
XX
Signature of Legally Responsible Person (submission must include original signature) Date Signed
Name (printed Title
DO NOT INCLUDE A COPY OF THE STORMWATER MANAGEMENT PLAN
DO NOT INCLUDE PAYMENT – AN INVOICE WILL BE SENT AFTER THE CERTIFICATION IS ISSUED.
NOTICE OF REASSIGNMENT OF PERMIT COVERAGE AND GENERAL PERMIT APPLICATION
STORMWATER DISCHARGE ASSOCIATED WITH CONSTRUCTION ACTIVITIES
Application Part 2 page 1 of 1 updated 4/2011
PART II - AMENDMENT TO THE CURRENT PERMIT CERTIFICATION
TO BE COMPLETED BY CURRENT PERMITTEE
CERTIFICATION NUMBER COR03________________ THIS PERMIT WILL NOT BE TERMINATED
II.A. CURRENT PERMIT LEGAL CONTACT INFORMATION Check if information has changed
Company Name:
Legally Responsible Person: First Name: Last Name:
Title:
Mailing Address:
City, State and Zip Code:
Phone:
Email Address:
2. PERMITTED FACILITY INFORMATION
Name of Plan, Project or Development:
Latitude and Longitude (approximate center of site to nearest 15 seconds using one of following formats):
Latitude: Longitude: (e.g., 39°42’11’’, 104°55’57’’)
degrees /minutes/ seconds
OR
degrees/ minutes/ seconds
Latitude: Longitude: (e.g., 39.703°, 104.933’)
degrees (to 3 decimal places) degrees (to 3 decimal places)
3. MAP (Attachment)
Map: Attach a map that indicates the site location and that CLEARLY shows the boundaries of the area that will be retained under this
current certification. Maps must be no larger than 11x17 inches.
4. NATURE OF CONSTRUCTION ACTIVITY
Check the appropriate box(s) or provide a brief description that indicates the general nature of the construction activities. (The full
description of activities must be included in the Stormwater Management Plan.)
□ Single Family Residential Development
□ Multi-Family Residential Development
□ Commercial Development
□ Other, Describe:
9. REQUIRED SIGNATURES Certification for Reassignment
“I certify under penalty of law that I have personally examined and am familiar with the information submitted in Part II of this application
and all attachments in reference to Part II and that, based on my inquiry of those individuals immediately responsible for obtaining the
information, I believe that the information is true, accurate and complete. I am aware that thereare significant penalties for submitting false
information, including the possibility of fine or imprisonment.
“As the permittee currently covered by the above-referenced certification, I hereby agree to reassign the permit coverage for the area and
activity described in Items I.b. and I.c., and all responsibilities thereof, from the above-referenced permit certification to the new permittee
listed in Part I of this form.”
Signature of Legally Responsible Person (submission must include original ink signature) Date Signed
Name (printed) Title
Page 1 of 3 Dec 2014
FOR DIVIISION USE ONLY
Effective date____________________
COLORADO WATER QUALITY CONTROL DIVISION TERMINATION APPLICATION
Print or type all information. Mail original form with ink signature to the following address. Emailed and Faxed forms
will not be accepted. All items must be filled out completely and correctly. If the form is not complete, you will be
asked to resubmit it.
Colorado Dept of Public Health and Environment
Water Quality Control Division WQCD-P-B2
4300 Cherry Creek Drive South
Denver CO 80246-1530
PART A. IDENTIFICATION OF PERMIT OR AUTHORIZATION - Please limit submission to one permit, certification,
or authorization per form. All permit termination dates are effective on the date approved by the division.
Processing times vary by type of discharge. Some discharge types require onsite inspections to verify
information in this application.
PERMIT, CERTIFICATION, OR AUTHORIZATION NUMBER (DOES NOT END IN 0000)____________________
PART B. PERMITTEE INFORMATION
Company Name______________________________________________________________________________
Legal Contact First Name____________________________Last Name_________________________________
Title________________________________
Mailing Address______________________________________________________________________________
City __________________________________State_______________Zip Code__________________________
Phone____________________________Email address______________________________________________
PART C. FACILITY OR PROJECT INFORMATION
Facility/Project name________________________________________________________________________
Location/Address ___________________________________________________________________________
City __________________________________________County_______________________________________
Local contact name________________________________________Title______________________________
Phone___________________________ Email address_______________________________________________
PART D. TERMINATION INFORMATION QUESTIONS Provide information for Part D that applies to your facility and
termination request. Not all questions need to be answered- only the part that applies to your facility.
Part D1 covers facilities no longer in operation.
Part D2 covers mining facilities no longer in operation
Part D3 covers facilities in operation but no longer discharging or needing permit coverage.
Part D4 covers Stormwater Construction facilities where construction is complete and the site is stabilized.
**Please answer questions as completely as possible to assist in timely approval of this termination request.**
D1. FACILITY IS NO LONGER IN OPERATION AT THIS LOCATION
All activities and discharges at the identified site have ceased; all potential pollutant sources have been
removed; all industrial wastes have been disposed of properly; all DMR’s, Annual Reports, and other reports
have been submitted; and all elements of a Stormwater Management Plan have been completed (if this
applies).
**FOR LAGOONS: please reference “information regarding Domestic
Treatment Works Closure at Wastewater Treatment Facilities”
COLORADO WATER QUALITY CONTROL DIVISION TERMINATION APPLICATION www.coloradowaterpermits.com
Page 2 of 3 Dec 2014
D2. MINING FACILITY IS NO LONGER IN OPERATION AT THIS LOCATION.
Sand and Gravel, Coal or Hard Rock Mining
A. Mining operation is no longer discharging process/treated water. Bond has not been released by DRMS.
A stormwater only permit is requested at this time. Attach application for Stormwater Only permit.
B. Reclamation of mining site is completed. Bond has been released by DRMS.
___ YES Attach a copy of the Bond release letter. ___NO Explain below:
C. Reclamation of mining site is complete. Is there any continued mine drainage? Eg. Adits or unreclaimed
waste piles? ___ YES , Please explain, attach additional pages as necessary.
D3. FACILITY IS STILL IN OPERATION BUT IS NO LONGER DISCHARGING OR NO LONGER NEEDS A PERMIT
A. Facility continues to operate, however the activity producing the discharge has ceased (including
changes in SIC Code resulting in change in duty to apply).
B. Termination is based on alternate disposal of discharges (discharge is being disposed of in another way)
a. Solid waste disposal unit (e.g. evaporative ponds)
b. No Exposure Exclusion (for industrial stormwater facilities only.) NOX Number_________________
c. Combined with another authorized discharge. Permit Number ____________________
d. Permit is not required (includes coverage by low risk policy, etc.) – please explain, attach
additional pages if necessary
C. PERMITTEE IS NO LONGER THE OWNER/OPERATOR OF THE SITE and all efforts have been made to
transfer the permit to appropriate parties. Please attach copies of registered mail receipts, letters,
etc.
D4. STORMWATER CONSTRUCTION FACILITIES WHERE CONSTRUCTION IS COMPLETE (Select A, B, or C)
A. SITE IS FINALLY STABILIZED OR CONSTRUCTION WAS NOT STARTED
a. The permitted activities meet the requirements for FINAL stabilization in accordance with the
permit, the Stormwater Management Plan, and as described in item b. (explanation can be
construction activities were not started).
b. Describe the methods used to meet final stabilization. (Required)
*Final Stabilization defined on page 3
COLORADO WATER QUALITY CONTROL DIVISION TERMINATION APPLICATION www.coloradowaterpermits.com
Page 3 of 3 Dec 2014
D4. STORMWATER CONSTRUCTION FACILITIES WHERE CONSTRUCTION IS COMPLETE (Continued)
B. ALTERNATIVE PERMIT COVERAGE OR FULL REASSIGNMENT
a. All ongoing construction activities including all disturbed areas, covered under the permit
certification listed in Part B have coverage under a separate CDPS Stomwater Construction
permit. The Division’s Reassignment form was used by the permittee to reassign all areas and
activities.
b. Permit certification number covering the ongoing activities (Required)_____________________
C. PERMITTEE IS NO LONGER THE OWNER OR OPERATOR OF THE FACILITY
All efforts have been made to transfer the permit to appropriate parties.
Please attach copies of registered mail receipt, letters, etc.
*Final stabilization is reached when: all ground surface disturbing activities at the site have been completed
including removal of all temporary erosion and sediment control measure, and uniform vegetative cover has been
established with an individual plant density of at least 70 percent of predisturbance levels, or equivalent
permanent, physical erosion reduction methods have been employed.
PART E. CERTIFICATION SIGNATURE REQUIRED FOR ALL TERMINATION REQUESTS
I certify under penalty of law that this document and all attachments were prepared under my direction and/or
supervision in accordance with a system designed to assure that qualified personnel properly gather and
evaluate the information submitted. Based on my inquiry of the person or persons who manage the system, or
those individuals immediately responsible for gathering the information, the information submitted is to the
best of my knowledge and belief, true, accurate, and complete. I am aware that there are significant
penalties for submitting false information, including the possibility of fine and imprisonment for knowing
violations. “ (See 18 USC 1001 and 33 USC 1319)
I certify that I am the legal representative of the above named company (PART B page 1).
Applies to Stormwater Construction terminations:
I understand that by submitting this notice of termination, I am no longer authorized to discharge stormwater
associated with construction activity by the general permit. I understand that discharging pollutants in
stormwater associated with construction activities to the waters of the State of Colorado, where such
discharges are not authorized by a CDPS permit, is unlawful under the Colorado Water Quality Control Act and
the Clean Water Act.
Signature of Legally Responsible Party Date Signed
Name (printed) Title
Signatory requirements: This termination request shall be signed, dated, and certified for accuracy by the permittee in
accord with the following criteria:
1. In the case of a corporation, by a principal executive officer of at least the level of vice-president, or his or her
duly authorized representative, if such representative is responsible for the overall operation of the operation
from which the discharge described herein originates;
2. In the case of a partnership, by a general partner;
3. In the case of a sole proprietorship, by the proprietor;
4. In the case of a municipal, state, or other public operation, by either a principal executive officer, ranking elected
official, or other duly authorized employee.
APPENDIX C
EROSION AND SEDIMENT CONTROL INSPECTION FORM
'3036%(3()4%681)283*86%274368%8-32
78361;%8)6*-)0(-274)'8-326)4368%'8-:)'327869'8-32
6)%732*36-274)'8-32)<'097-32
6SYXMRI-RWTIGXMSR
TEKISJSVQ '(38*
TEKISJSVQ '(38*
7XSVQ[EXIV1EREKIQIRX*MIPH-RWTIGXMSR6ITSVX-RWXVYGXMSRW
7XEXI[EXIVWEVIHIJMRIHXSFIER]ERHEPPWYVJEGIERHWYFWYVJEGI[EXIVW[LMGLEVIGSRXEMRIHMRSVJPS[XLVSYKLXLIWXEXI
MRGPYHMRKWXVIEQWVMZIVWPEOIWHVEMREKIHMXGLIWWXSVQHVEMRWKVSYRH[EXIVERH[IXPERHWFYXRSXMRGPYHMRK[EXIVWMRWI[EKI
W]WXIQW[EXIVWMRXVIEXQIRX[SVOWSVHMWTSWEPW]WXIQW[EXIVWMRTSXEFPI[EXIVHMWXVMFYXMSRW]WXIQWERHEPP[EXIV[MXLHVE[RJSV
YWIYRXMPYWIERHXVIEXQIRXLEZIFIIRGSQTPIXIH
7XSVQ[EXIV1EREKIQIRX*MIPH-RWTIGXMSR6ITSVX-RWXVYGXMSRW
APPENDIX D
SPILL REPORT FORM
Construction Stormwater Pollution Prevention
Spill Report Form
Spill Reported By: Phone Number:
Details
Date Reported: Time:
Date of Spill: Time:
Name of the Facility:
Describe Spill Location and Events Leading to Spill:
Material Spilled:
Source of Spill:
AMOUNT OF THE SPILL (GALLONS OR POUNDS):
Containment and Cleanup
Containment or Cleanup Action:
Date and Time Cleanup Completed or Terminated:
Description of Materials Contaminated:
Label on the Drum of Cleanup Materials:
Signed:
Contractor Superintendent or
Environmental Inspector
APPENDIX E
REPORTING CHEMICAL SPILLS AND RELEASES IN COLORADO
REPORTING
ENVIRONMENTAL RELEASES
IN COLORADO
Hazardous Materials and Waste Management Division
(303) 692-3300
January 2009
Purpose of this Guidance
This guidance is intended to provide an overview of various reporting
requirements for a variety of releases to the environment. Please check all of
the possible requirements for reporting. This guidance does not cover all
potential release scenarios. This guidance is not intended to modify or replace
statutes or regulations, which undergo periodic revisions. In the event of a
conflict between this guidance and statutes or regulations, the statutes and
regulations govern.
Some reporting requirements are complex and overlapping, and this guidance
does not go into details of all situations. If a release situation is not described
in this guidance, or if clarification is desired, please obtain an official
interpretation from the governing agency enforcing the statute or regulation.
i
Table of Contents
Contact Information ...................................................................................................................................... ii
Colorado Environmental Release Reporting..................................................................................................1
A. Comprehensive Environmental Response, Compensation and Liability Act (CERCLA)...................1
B. Emergency Planning and Community Right-to-Know Act (EPCRA).................................................3
Reportable Quantities Under CERCLA and EPCRA ............................................................................4
Exceptions and Exclusions.....................................................................................................................5
C. Resource Conservation and Recovery Act (RCRA) ............................................................................7
D. Radiation Control .................................................................................................................................9
E. Clean Water Act ...................................................................................................................................9
F. Safe Drinking Water Act ....................................................................................................................10
G. Clean Air Act .....................................................................................................................................10
H. Underground Storage Tanks (USTs) and Aboveground Storage Tanks (ASTs) ...............................11
I. Hazardous Materials Transportation....................................................................................................12
J. Oil and Gas Exploration and Production.............................................................................................15
K. Polychlorinated Biphenyls .................................................................................................................16
Abbreviations & Definitions........................................................................................................................17
ii
Contact Information
Release Reporting Numbers
National Response Center (NRC) 1 (800) 424-8802
24-hour reporting
Colorado Environmental Release and Incident Reporting Line 1 (877) 518-5608
24-hour reporting
Radiation Incident Reporting Line (303) 877-9757
24-hour reporting
Colorado State Patrol (303) 239-4501
24-hour reporting
US EPA Region 8 Emergency Response Spill Report Line 1 (800) 227-8914
24-hour reporting
Division of Oil and Public Safety (Dept. of Labor and Employment) (303) 318-8547
Fax (303) 318-8546
Oil and Gas Conservation Commission (Dept. of Natural Resources) (303) 894-2100
Division of Reclamation, Mining and Safety (Dept. of Natural Resources) (303) 866-3567
Colorado Public Utilities Commission Gas Pipeline Safety Section (303) 894-2851
(Dept. of Regulatory Agencies)
Local Emergency Planning Committee (Dept. of Local Affairs) (720) 852-6603
Business hours only - to obtain a list of LEPC contacts
Colorado Department of Public Health and Environment
Mailing Address:
Colorado Department of Public Health and Environment
4300 Cherry Creek Drive South
Denver, CO 80246-1530
Office Hours:
Monday – Friday, except holidays 8:00 am – 5:00 pm
Environmental Divisions
Air Pollution Control Division (303) 692-3100
Website http://www.cdphe.state.co.us/ap/
Email comments.apcd@state.co.us
Consumer Protection Division (303) 692-3620
Website http://www.cdphe.state.co.us/cp/
Email comments.cpd@state.co.us
Hazardous Materials and Waste Management Division (303) 692-3300
Website http://www.cdphe.state.co.us/hm/
Email comments.hmwmd@state.co.us
Water Quality Control Division (303) 692-3500
Website http://www.cdphe.state.co.us/wq/
Email comments.wqcd@state.co.us
Reporting Environmental Releases in Colorado January 2009
Colorado Environmental Release Reporting
Additional reporting requirements
may be found in permits, licenses,
registrations, contingency and
pollution prevention plans, fire
codes, and local ordinances.
When a release of a hazardous material or other substance occurs to the environment, there are a
number of reporting and notification requirements that must be followed by the company or
individual responsible for the release. Environmental releases must be reported to the appropriate
authorities so that necessary response actions are taken in a timely fashion to ensure maximum
protection of human health and the environment.
However, taking appropriate and timely response actions
do not relieve you of your responsibility to report a release.
In addition, the responsible party is always liable for any
damages that may result from a release, and is responsible
for appropriate clean up actions whether or not the release
is required to be reported.
There is no penalty for over-reporting, but there are for failing to report a release. If you are unsure
if a release needs to be reported, the Colorado Department of Public Health and Environment (the
Department) recommends that releases be reported immediately even if the quantity of the release
has not yet been determined. Your follow-up report will provide details that explain why the
release was or was not reportable.
“Release” includes any spilling, leaking, pumping, pouring, emitting, emptying, discharging,
injecting, escaping, leaching, dumping, or disposing into the environment, including abandonment
or discarding of barrels, containers, and other closed receptacles containing any hazardous
substance, pollutant, or contaminant.
Most spills and releases are
covered by more than one
reporting requirement, and all
requirements must be met.
"Environment" is generally defined as any surface water, ground water, drinking water supply, land
surface, subsurface strata, or ambient air. Releases into containment devices and those completely
contained within a building or other structure are not releases into the environment as long as the
hazardous substance does not volatilize into the ambient air or
otherwise have the potential to enter the environment (e.g.,
through the floor or cracks in the floor). Releases of a substance
into a storm drain or sewer, or onto a parking lot or roadway, are
considered to be releases to the environment.
Release reporting requirements are based on the type of material released and/or the situation under
which the release occurred. Additional reporting requirements may be found in permits, licenses,
registrations, contingency and pollution prevention plans, fire codes, and local ordinances. Please
check all of the possible requirements for reporting. Most spills and releases are covered by more
than one reporting requirement, and ALL requirements must be met. Enforcement action may be
taken against those who fail to provide required notifications or reports.
A. Comprehensive Environmental Response, Compensation and Liability Act
(CERCLA)
The Comprehensive Environmental Response, Compensation and Liability Act, commonly known
as Superfund or CERCLA, provided broad Federal authority to respond directly to releases or
threatened releases of hazardous substances that may endanger public health or the environment.
This Act also enabled revision of the National Contingency Plan, which provides the guidelines and
1
Reporting Environmental Releases in Colorado January 2009
procedures needed to respond to releases and threatened releases of hazardous substances,
pollutants, or contaminants.
Under CERCLA, the US EPA was directed to establish reporting quantities for all hazardous
substances. The term "hazardous substance" is defined in CERCLA Section 101(14). These are
defined by reference to substances that are listed or designated under other environmental statutes.
They include:
all hazardous air pollutants (HAPs) listed under Section 112(b) of the Clean Air Act (CAA).
Radio-nuclides are hazardous substances because EPA designated them generically as
hazardous air pollutants under Section 112(b) of the Clean Air Act. Even though the source
of their listing is the Clean Air Act, releases of radionuclides to all media, not just to air, are
covered by CERCLA's reporting requirements.
toxic pollutants that are subject to pretreatment standards under Section 307(a) of the Clean
Water Act (CWA) and toxic pollutants that present an imminent danger to public health
when discharged to waters of the United States as designated under Section 311(b)(2)(A) of
the Clean Water Act. All Clean Water Act hazardous substances are CERCLA hazardous
substances, but only some CERCLA hazardous substances are Clean Water Act hazardous
substances.
wastes that are regulated as listed and/or characteristic
hazardous wastes under the Resource Conservation and
Recovery Act (RCRA). This includes thousands of
hazardous wastes that are not specifically listed but that
exhibit one or more of the characteristics of ignitability,
reactivity, corrosivity or toxicity. A material is
considered to be a release of a CERCLA hazardous
substance if the material was a waste prior to release, or if
the substance is not cleaned up for reuse and thus must be
disposed of as a RCRA hazardous waste after release.
Report releases at or above
the reportable quantity (RQ)
within 24 hours:
Hazardous air pollutants
under Section 112(b) of
Clean Air Act
Toxic pollutants under
Section 307(a) or under
Section 311(b)(2)(A) of
Clean Water Act
RCRA hazardous wastes
Elements, compounds or
substances under Section
102 of CERCLA
any element, compound, mixture solution or substance
designated under Section 102 of CERCLA that may
present substantial danger to public health or welfare or
the environment.
any imminently hazardous chemical substance or mixture that EPA has taken action against
under Section 7 of the Toxic Substances Control Act (TSCA). Any hazardous chemical
substance or mixture that EPA has taken action against under this Act would automatically
become a hazardous substance. To date, EPA hasn't designated any hazardous substances
under the Toxic Substances Control Act.
The person in charge of a facility or vessel must immediately report a release to the National
Response Center (NRC) as soon as they have knowledge of a release to the environment of a
CERCLA hazardous substance at or above the reportable quantity assigned to that substance within
a 24-hour period. If the release is a mixture or solution of hazardous substances, it must be reported
if the reportable quantity for any hazardous constituents is met or exceeded. If the responsible party
doesn't know the quantity of one or more of the hazardous constituents contained in a mixture or
solution, they must report the release if the total amount of the mixture or solution released equals
or exceeds the reportable quantity for the hazardous constituent with the lowest reportable quantity.
Reporting is also required if a non-CERCLA substance is released into the environment and rapidly
Reporting Environmental Releases in Colorado January 2009
These notification and reporting requirements are included in 40 CFR Part 302. A list of CERCLA
hazardous substances is included in Table 302.4 of these regulations.
B. Emergency Planning and Community Right-to-Know Act (EPCRA)
The Superfund Amendments and Reauthorization Act of 1986 reauthorized the Comprehensive
Response, Compensation and Liability Act to continue cleanup activities around the country.
Several amendments, definitions, clarifications and technical requirements were added to the
legislation, including additional enforcement authorities. Title III of the Superfund Amendments
also authorized the Emergency Planning and Community Right-to-Know Act (EPCRA), which
established the community's right to information about the chemicals that are stored, used at and/or
released from local facilities. It also established a framework for developing emergency plans for
responding to releases and reporting requirements for facilities.
A list of EPCRA threshold
planning quantities (TPQ) is
included in 40 CFR Part
355 Appendices A & B.
Under this Act, owners or operators of facilities at which a
hazardous substance or extremely hazardous substance is produced,
used or stored must provide immediate notification to the National
Response Center (NRC), the State Emergency Response
Commission (SERC) and the affected Local Emergency Planning
Committee (LEPC) when there is a release of a hazardous substance or extremely hazardous
substance with the potential to affect off-site persons that equals or exceeds its reportable quantity
within a 24-hour period. If the release is an EPCRA extremely hazardous substance, but not a
CERCLA hazardous substance, then only the SERC and LEPC need to be notified. Note – there
may be more than one SERC and/or LEPC potentially affected by a release. Don’t wait until there
is a release to contact the SERC and LEPC(s) to ensure that the correct contacts will be made in the
event of a spill. For a list of LEPCs, contact the Colorado Department of Local Affairs.
The owner or operator of the facility must report a release as soon as they know about it. In
addition to immediate telephone notification, the responsible party must also send a follow-up
written report as soon as practicable after the release to both the State Emergency Response
Commission (in this case, to the Colorado Department of Public Health and Environment) and the
Local Emergency Planning Committee. This report must describe the release, associated response
actions taken, and any known or anticipated health risks associated with the release.
A table of CERCLA reportable quantities
(RQ) is includedin40CFR Section 302.4.
Although EPCRA requires notification only for
releases that have the potential to affect persons beyond
the facility boundary, EPA and the Colorado
Department of Public Health and Environment strongly encourage facilities to report onsite releases
if there is ANY potential for the release to migrate offsite. The burden of proof is on the facility to
show that any release into the environment of a reportable quantity or more of a hazardous
substance or extremely hazardous substance has NO POTENTIAL for offsite migration (e.g., via
groundwater, the wind or getting tracked offsite by workers and vehicles).
The State Emergency Response Commission (SERC) in Colorado is called the Colorado
Emergency Planning Commission (CEPC). It consists of representatives of the Colorado
Department of Public Health and Environment – Hazardous Materials and Waste Management
Division, the Colorado Department of Local Affairs – Colorado Division of Emergency
Management and the Division of Local Government, the Colorado Department of Public Safety –
3
Reporting Environmental Releases in Colorado January 2009
Fire Safety Division, and the Colorado State Patrol. The Commission also includes representatives
of affected industries, local governments, public interest or community groups and the Local
Emergency Planning Committee (LEPC) community. The Colorado Department of Public Health
and Environment represents the Commission for reporting purposes.
Reportable Quantities Under CERCLA and EPCRA
All reportable quantities are listed in pounds (except radionuclides, which are in curies). Congress
established a one pound reportable quantity for all hazardous substances and extremely hazardous
substances until EPA could evaluate each substance and adjust the reportable quantity to a level
more appropriate for the substance. During this assessment, each hazardous substance was
evaluated for six primary criteria: aquatic toxicity, mammalian toxicity, ignitability, reactivity,
chronic toxicity, and potential carcinogenicity. Reportable quantities for CERCLA hazardous
substances are listed in 40 CFR Section 302.4.
EPCRA extremely hazardous substances that are also hazardous substances under CERCLA have
the same reportable quantity that is applicable under CERCLA. If not also listed as a CERCLA
hazardous substance, extremely hazardous substances have a reportable quantity equal to the
EPCRA threshold planning quantity (TPQ) for that substance. The threshold planning quantity is
the quantity designated for each chemical in 40 CFR Part 355 Appendices A and B that triggers
notification by facilities to the State Emergency Response Commission that those facilities are
subject to emergency planning requirements.
For convenience, reportable quantities for hazardous substances and extremely hazardous
substances can also be found in the EPA List of Lists (EPA 550-B-01-003). Bear in mind that
because this document is only updated periodically, it may not contain recently added substances.
EPCRA extremely hazardous substances that
are also CERCLA hazardous substances have
the same RQ as under CERCLA.
EPCRA extremely hazardous substances that
are not listed under CERCLA have an RQ
equal to their TPQ under EPCRA.
All concurrent releases of the same substance from a single facility must be combined to determine
if a reportable quantity has been met or exceeded. Releases of different substances from a single
facility should not be combined for purposes of determining if the releases need to be reported.
Rather, each substance should be evaluated separately to determine if one or more reportable
quantities have been met or exceeded. For example, spilling a mixture containing half the
reportable quantity of one hazardous substance and
half the reportable quantity of another hazardous
substance does not trigger the reporting
requirement. Releases from separate facilities
should be treated as separate releases and should
not be combined to determine if a reportable
quantity has been met or exceeded.
Mixtures
Most hazardous substances and extremely hazardous substances are not used or stored in pure form,
but are mixtures or solutions. If a mixture of hazardous substances or extremely hazardous
substances is released and the concentration of all hazardous substances and extremely hazardous
substances in the mixture is known, then you must calculate the amount of each hazardous
substance and extremely hazardous substance that has been released. If there is more than one
hazardous substance or extremely hazardous substance in a mixture, you must check the reportable
quantity for each substance. The release must be reported if the reportable quantity for any
4
Reporting Environmental Releases in Colorado January 2009
hazardous substance or extremely hazardous substance has been met or exceeded. If the
concentrations of the hazardous substances or extremely hazardous substances in the mixture are
not known, then the release must be reported when the total amount of the mixture released equals
or exceeds the reportable quantity for the constituent with the lowest reportable quantity.
Radionuclides
Releases of radionuclides in a mixture are additive. These releases are subject to reporting:
if each radionuclide in a released mixture or solution is known, then the ratio between the
quantity released and the reportable quantity for the radionuclide must be determined for
each radionuclide. If the sum of the ratios for the radionuclides in the mixture or solution
released is equal to or greater than one, it must be reported.
if all of the radionuclides in the mixture are known but the quantity released of one or more
of the radionuclides is unknown, it must be reported if the total quantity released is equal to
or greater than the lowest reportable quantity of any one radionuclide in the mixture.
if one or more radionuclides in the mixture is unknown, it must be reported if the total
quantity released is equal to or greater than either one curie or the lowest reportable quantity
of any of the known radionuclides in the mixture (whichever is lower).
Exceptions and Exclusions
Petroleum Products
A release of a petroleum product
containing a reportable quantity of
an EPCRA extremely hazardous
substance is reportable.
Under the Comprehensive Environmental Response, Compensation and Liability Act (CERCLA),
petroleum products are excluded from the definition of hazardous substance. "Petroleum product"
includes crude oil, any fraction of crude oil that is not specifically listed as a hazardous substance,
natural and synthetic gases, and mixtures of natural and synthetic gases. EPA interprets petroleum
as including those amounts of hazardous substances, like
benzene, that are indigenous to crude oil or its fractions or
that are normally added during the refining process.
Hazardous substances added to the petroleum or increased
in concentration solely as a result of contamination during
use are not included in the petroleum exclusion.
Unlike the petroleum exclusion under CERCLA, extremely hazardous substances that are naturally
occurring in petroleum products or that are normally added during refining are subject to reporting
under the Emergency Planning and Community Right-to-Know Act (EPCRA). Therefore, a release
of a petroleum product containing a reportable quantity of one or more extremely hazardous
substances is reportable to the Colorado Emergency Planning Commission (CERC) and the Local
Emergency Planning Committee (LEPC) if a reportable quantity is met or exceeded.
Note: releases of oil and petroleum to water are also covered
under the Clean Water Act (Section E of this document).
Releases of petroleum from regulated storage tanks are covered
under the Colorado storage tank regulations (Section H of this
document).
The responsible party is always
responsible for appropriate clean
up actions whether or not the
release is required to be reported.
5
Reporting Environmental Releases in Colorado January 2009
Metals
Under normal handling and use, solid forms of most metals present few health hazards. Metal fines
and metal dust may cause irritation of the eyes, skin, and respiratory system, and fine particles of
certain metals, including antimony, arsenic, beryllium, cadmium, chromium, copper, lead, nickel,
selenium, silver, thallium, or zinc, dispersed in the air can be an explosion and/or health hazard.
EPA has determined that releases of these metals with particles larger than 100 micrometers would
not normally require response action due to the unlikely inhalation of such large particles.
However, notification of the release of a reportable quantity of antimony, arsenic, beryllium,
cadmium, chromium, copper, lead, nickel, selenium, silver, thallium, or zinc is required if the mean
diameter of the particles released is less than 100 micrometers (0.004 inches). An exception to this
is a release of a metal classified as a radionuclide, which does not qualify for this exemption even if
the particles meet the size criteria.
Naturally Occurring Radionuclides
Notification of the release of naturally occurring radionuclides from large land holdings, like parks
or golf courses, is not required. EPA broadened this exemption to include land containing ore
reserves even if the undisturbed ores contain elevated natural concentrations of radionuclides, and
to land disturbance activities including farming, construction, and disturbance incidental to
extraction activities at all mines except uranium, phosphate, tin, zircon, hafnium, vanadium,
monazite, and rare earth mines. Land disturbance incidental to extraction activities includes land
clearing, overburden removal and stockpiling, and excavating, handling, transporting and storing
ores and other raw materials. Land disturbance incidental to extraction also includes replacing
materials in mined-out areas as long as those materials have not been processed and don't contain
elevated radionuclide concentrations. Notification of the release of naturally occurring
radionuclides from sites where coal and coal ash (fly ash, bottom ash, boiler slag) are stored or
disposed is also not required.
Federally Permitted Releases
Releases that are regulated under one or more of the following programs are exempt from CERCLA
and EPCRA reporting requirements:
permitted discharges under the National Pollutant Discharge Elimination System (NPDES);
permitted dredge and fill discharges under Section 404 of the Clean Water Act;
permitted and interim status hazardous waste units under the Resource Conservation and
Recovery Act;
permitted discharges under the Marine Protection, Research and Sanctuaries Act;
permitted injection of fluids under the Underground Injection Control (UIC) program in
accordance with the Safe Drinking Water Act;
air emissions subject to permit or control regulations under the Clean Air Act;
permitted or allowed injection of fluids to develop crude oil or natural gas supplies;
discharges of contaminants to Publicly Owned Treatment Works (POTW) if in compliance
with pretreatment requirements under the Clean Water Act;
releases of certain nuclear materials if in compliance with a license, permit, regulation or
order issued in accordance with the Atomic Energy Act.
Registered Pesticides
The normal application of a pesticide product registered under the Federal Insecticide, Fungicide
and Rodenticide Act (FIFRA) is exempt from CERCLA and EPCRA reporting. This exemption
includes the handling and storage of the product by an agricultural producer, but does not include
6
Reporting Environmental Releases in Colorado January 2009
any spills of the pesticide. Pesticide spills are reportable if the amount spilled meets or exceeds the
reportable quantity.
Continuous Releases
A continuous release is a release that occurs without interruption or abatement or that is routine,
anticipated, intermittent, and incidental to normal operations or treatment processes. When a
release of this type occurs, officials do not have to be notified each time. Instead, the facility can
report it as a continuous release to the National Response Center, the Colorado Emergency Planning
Commission and the Local Emergency Planning Committee(s) by telephone. This should be
followed by a written report submitted to EPA Region 8, the Colorado Department of Public Health
and Environment and the Local Emergency Planning Committee within 30 days of the initial
telephone call. The written report should provide information about the source, composition, and
normal range of the release. Periodic follow-up reports may also be required. Any release that
exceeds the normal range (called a “statistically significant increase”) must be reported immediately
to the National Response Center, the Colorado Department of Public Health and Environment and
the Local Emergency Planning Committee as if they were new release events. The normal range is
determined by the amount of a hazardous substance released over any 24-hour period under normal
operating conditions during the preceding year. Only releases that are both continuous and stable in
quantity and rate can be included in the normal range.
Continuous release of an extremely hazardous substance that is not a CERCLA hazardous substance
need only be reported to the Colorado Department of Public Health and Environment and the Local
Emergency Planning Committee. A written report should also be sent to these two agencies within
30 days and any statistically significant increases in the release should be reported to both agencies.
Periodic follow-up reports may also be required.
C. Resource Conservation and Recovery Act (RCRA)
All Resource Conservation and Recovery Act (RCRA) listed and characteristic hazardous wastes
are designated as hazardous substances under the Comprehensive Environmental Response,
Compensation and Liability Act (CERCLA). For more information on listed and characteristic
hazardous wastes, please review the Hazardous Waste Identification Guidance Document from the
Hazardous Materials and Waste Management Division (http://www.cdphe.state.co.us/hm/hwid.pfd).
The reportable quantity for F- and K-listed hazardous wastes is based on the hazardous waste code.
If the composition and concentrations of all included constituents is not known, the reportable
quantity would be as listed for the waste code in 40 CFR Section 302.4. If the waste is analyzed
and the concentrations of ALL of its hazardous constituents are identified, then reportable quantities
of the specific constituents can be used to determine when reporting is required. For example, if a
release of an F005 listed hazardous waste occurred and the concentrations of the constituents
making up the waste were unknown, the reportable quantity would be 100 pounds. If it were known
that the F005 waste was comprised of 50% toluene (reportable quantity 1000 pounds) and 50%
methyl ethyl ketone (reportable quantity 5000 pounds), then the release would be reported when
2000 pounds of the mixture were released. [Since the reportable quantity for toluene is less than
that for methyl ethyl ketone, the amount of toluene released will determine when the release must
be reported. Since the mixture is 50% toluene, it would take 2000 pounds of the mixture to meet
the reportable quantity of 1000 pounds for toluene.]
7
Reporting Environmental Releases in Colorado January 2009
P- and U-listed hazardous wastes are reported based on the reportable quantity for the hazardous
substance that the waste is listed for. For example, the reportable quantity for hazardous waste code
U122 (formaldehyde) is 100 pounds. For the purposes of release reporting, it doesn't matter if the
formaldehyde is used or unused or is the "sole active ingredient" in order to be reportable. (Related
note: Colorado's hazardous waste regulations (6 CCR 1007-3) do not include the footnote regarding
sole active ingredients. In Colorado, chemicals may have more than one active ingredient and still
meet the listing description.)
All RCRA listed and characteristic
hazardous wastes are designated
as hazardous substances under
CERCLA.
Unlisted hazardous wastes exhibiting the characteristics of
ignitability, corrosivity and/or reactivity have a reportable
quantity of 100 pounds unless the concentrations of all the
constituents in the waste are known. If the waste is analyzed
and the concentrations of ALL its hazardous constituents are
identified, the reportable quantities of the specific constituents should be used to determine when
reporting is required. For example, a corrosive-only waste of unknown composition has a
reportable quantity of 100 pounds. If the waste is analyzed to determine that it was a 50% solution
of hydrochloric acid in water, then the reportable quantity of the solution would be 10,000 pounds.
[The reportable quantity for hydrochloric acid is 5000 pounds. Therefore it would take 10,000
pounds of the 50% solution to meet the reportable quantity for hydrochloric acid.]
Unlisted hazardous wastes that exhibit toxicity have reportable quantities specific to the constituent
on which the characteristic of toxicity is based. The reportable quantity applies to the waste itself,
not just to the toxic contaminant. If an unlisted hazardous waste exhibits toxicity on the basis of
more than one contaminant, the reportable quantity for the waste is the lowest of the reportable
quantities for those contaminants. For example, if a waste exhibits toxicity characteristics for the
heavy metals lead (D008) and selenium (D010), with reportable quantities of 10 and 100 pounds
respectively, the reportable quantity would be 10 pounds of the waste, or the lower of the two
reportable quantities. If a waste exhibits a toxicity characteristic and one or more other hazardous
waste characteristics, the reportable quantity for that waste is the lowest of the applicable reportable
quantities.
These notification and reporting requirements are included in 40 CFR Part 302.
Permitted and Interim Status Treatment, Storage and Disposal Facilities and Large
Quantity Generators of Hazardous Waste
Large quantity generators of hazardous waste and hazardous waste treatment, storage and disposal
facilities (TSDF) are required to have and implement a contingency plan that describes the actions
facility personnel must take in response to fires, explosions, or any unplanned sudden or non-
sudden release of hazardous waste or hazardous waste constituents to air, soil, surface water or
groundwater at the facility. Whenever there is an imminent or actual emergency situation,
appropriate State and local agencies with designated response roles as described in the contingency
plan must be notified immediately. Appropriate local authorities and the National Response Center
or government official designated as the regional on-scene coordinator must be notified
immediately if the facility's emergency coordinator determines that the facility has had a release,
fire, or explosion that could threaten human health or the environment outside the facility. A
treatment, storage, and disposal facility's permit generally requires reporting to the Colorado
Department of Public Health and Environment – Hazardous Materials and Waste Management
Division of any release, fire or explosion, even if the amount of the release is less than an otherwise
reportable quantity.
8
Reporting Environmental Releases in Colorado January 2009
The Department and local authorities must be notified when the facility is back in compliance and
ready to resume operations. In addition, the facility must send a written report to both the EPA
Regional Administrator and the Colorado Department of Public Health and Environment within 15
days of any incident that requires implementation of the facility contingency plan.
In the case of a release of hazardous waste stored in tanks, the facility must notify the Hazardous
Materials and Waste Management Division within 24 hours of a release to the environment of more
than one pound. A leak or spill of hazardous waste that is less than or equal to one pound from a
tank or tank system does not need to be reported if the release is immediately contained and cleaned
up. Within 30 days of the release, a written report must be submitted to the Division.
These notification and reporting requirements are included in 6 CCR 1007-3 Sections 264.56 and
265.56 and Sections 264.196(d) and 265.196(d).
D. Radiation Control
Releases of radionuclides are
reportable under CERCLA.
The state of Colorado has specific reporting requirements for stolen, lost or missing licensed or
registered sources of radiation. Each licensee or registrant must report to the Colorado Department
of Public Health and Environment by telephone in the event of lost, stolen or missing licensed or
registered radioactive materials, a lost, stolen, or missing radiation machine, releases of radioactive
materials, contamination events, and fires or explosions involving radioactive materials. Incidents
should be reported to the Radiation Incident Reporting Line. Based on the severity of the event,
notification may be required immediately, within 24 hours or within 30 days. A follow-up written
report must also be submitted to the Department within 30
days of initial notification. The licensee must also report any
additional substantive information regarding a loss or theft
incident within 30 days after learning of such information.
These release and notification requirements are contained in 6 CCR 1007-1 Sections 4.51 - 4.53.
E. Clean Water Act
The Clean Water Act (CWA) requires the person in charge of a facility or vessel to make an
immediate report to the National Response Center of discharges of harmful quantities of oil to
navigable waters as soon as they have knowledge of the release. In this case, oil means oil of any
kind or in any form including, but not limited to, petroleum, fuel oil, sludge, oil refuse, and oil
mixed with wastes other than dredged spoil. Discharges of oil that violate applicable water quality
standards and those that cause a film, sheen or discoloration of the surface of the water or adjoining
shorelines, or cause a sludge or emulsion to be deposited beneath the surface of the water or on
adjoining shorelines must be reported. In effect, this means that any discharge of oil to waters of
the United States must be reported to the National Response Center. These release and notification
requirements are contained in 40 CFR Part 110.
The Clean Water Act (CWA) also requires the person in charge of a facility or vessel to report to
the National Response Center the discharge of a designated hazardous substance from the vessel or
facility to waters of the United States in quantities that equal or exceed the reportable quantity as
soon as they have knowledge of the release. Under the Act, the US EPA was directed to establish
reporting quantities for all hazardous substances listed in Table 116.4 A and B (40 CFR Part 116),
which were designated as hazardous substances in accordance with Section 311(b)(2)(A) of the
9
Reporting Environmental Releases in Colorado January 2009
Clean Water Act. This designation includes any isomers and hydrates as well as any solutions and
mixtures containing these substances. Each of these substances is included in the CERCLA list of
hazardous substances (40 CFR Part 302 Table 302.4) and is assigned the reportable quantity listed
in Table 302.4 for that substance. These release and notification requirements are contained in 40
CFR Parts 116 and 117.
Under the Clean Water Act, anyone that has a National Pollutant Discharge Elimination System
(NPDES) permit must report to the National Response Center within 24 hours of becoming aware
of any unanticipated bypasses or upsets that cause an exceedance of the effluent limits in their
permit and any violation of their maximum daily discharge limits for any pollutant listed in the
permit. A written report must be provided within five days. Other instances of noncompliance
must be reported when monitoring reports are submitted.
The Clean Water Act also requires all industrial users of Publicly Owned Treatment Works
(POTWs) to notify their treatment plant immediately if they have a discharge that could cause
problems at the treatment plant.
These notification and reporting requirements are included in 40 CFR Parts 122 and 403.
State Requirements
A spill of any chemical, oil, petroleum product, sewage, etc., which may enter waters of the state of
Colorado (which include surface water, ground water, and dry gullies and storm sewers leading to
surface water) must be reported immediately to the Colorado Department of Public Health and
Environment. Any accidental discharge to the sanitary sewer system must be reported immediately
to the local sewer authority and the affected wastewater treatment plant. If a release occurs at a
mining operation, the Division of Reclamation, Mining and Safety should also be notified.
For more information regarding State reporting requirements under 25-8-601(2) CRS, please refer
to the “Guidance for Reporting Spills under the Colorado Water Quality Control Act and Colorado
Discharge Permits” adopted by the Water Quality Control Division. This policy is available at
http://www.cdphe.state.co.us/op/wqcc/Resources/Guidance/spillguidance.pdf.
F. Safe Drinking Water Act
The owner or operator of a public water system (community water systems, non-transient non-
community water systems, and transient non-community water systems) must immediately report
any credible threat to the water supply system to the Colorado Environmental Release and Incident
Reporting Line and to the local emergency manager. The local emergency manager may be the
county sheriff or a member of the fire department. A list of local emergency managers is available
from the Colorado Department of Local Affairs.
G. Clean Air Act
Hazardous air pollutants (HAPs) listed in Section 112(b) of the Clean Air Act (CAA) are designated
as hazardous substances under the Comprehensive Environmental Response, Compensation and
Liability Act (CERCLA). Hazardous air pollutants are known or suspected to cause cancer or other
serious health effects or adverse environmental effects. Health effects can include immunological,
neurological, reproductive, developmental, and respiratory problems. In some cases, hazardous air
10
Reporting Environmental Releases in Colorado January 2009
pollutants can be deposited onto soils or other surfaces, where they are taken in by plants and
animals and can accumulate in organic tissue or pass up the food chain due to the inability of
organisms to process the substance.
The release (or air emission) of a hazardous air pollutant that is allowed and less than any limit
specified in a facility's air permit is considered to be a federally permitted release. If the facility
releases more than is allowed under its air permit within a 24 hour period, the facility must report
the release if the quantity released exceeded the facility's permitted level by a reportable quantity or
more. For example, if a facility has an air permit that allows the release of 30 pounds of a
hazardous substance and that substance has a reportable quantity of 100 pounds, the facility would
have to report all releases of 130 pounds or more of that substance. Releases of less than 130
pounds would not need to be reported under CERCLA or EPCRA because even though the facility
exceeded its permit limit, the amount released did not exceed the permitted level by its reportable
quantity (in this case, 100 pounds) or more. If the air permit does not allow or does not specify the
release of a hazardous air pollutant, then releases in excess of the CERCLA / EPCRA reportable
quantity for that substance must be reported. Please be aware that other reporting requirements are
triggered, however, based on the facility's air permit. The Clean Air Act (CAA) requires that
permits for stationary air sources have language requiring prompt reporting of any emergencies,
upsets and deviations from what is allowed in the permit. Releases must be reported to the National
Response Center and to the Colorado Department of Public Health and Environment. Contact the
Air Pollution Control Division for details on additional air-related requirements that may also apply.
Hazardous air pollutants are included in the CERCLA list of hazardous substances in 40 CFR Part
302 and are assigned the reportable quantity listed in Table 302.4 for each substance.
State Requirements
In the case of excess emissions during an emergency or malfunction, the owner or operator must
notify the Colorado Department of Public Health and Environment as soon as possible, but no later
than noon of the next working day, and provide a written follow-up report to the Air Pollution
Control Division by the end of the facility’s next reporting period.
These notification and reporting requirements are included in 5 CCR 1001-2 Section II.E and 5
CCR 1001-5, Regulation 3 Part C, Section VII.C.
H. Underground Storage Tanks (USTs) and Aboveground Storage Tanks
(ASTs)
The reportable quantity for petroleum
from a regulated storage tank system
is 25 gallons.
Owners and operators of regulated storage tank systems
must report a release or suspected release of regulated
substances to the Division of Oil and Public Safety at the
Colorado Department of Labor and Employment within 24
hours by telephone or facsimile. If outside normal working hours or on a weekend or holiday and
emergency assistance is needed, the release can be reported to the Colorado Environmental Release
and Incident Reporting line at the Colorado Department of Public Health and Environment. Any
suspected release or release of unknown quantity is a reportable quantity unless the owner/operator
can conclusively show the release is less than the reportable quantity for the released substance.
11
Reporting Environmental Releases in Colorado January 2009
Under this program, the reportable quantity for petroleum releases is 25 gallons or more from
regulated aboveground and underground storage tank systems, or any amount that causes a sheen on
nearby surface water. This is interpreted to include releases from fuel pumps and fuel delivery
trucks while connected to the petroleum storage tank system. Releases of less than 25 gallons from
regulated petroleum storage tank systems, or a release of a hazardous substance that is less than the
CERCLA reportable quantity, do not need to be reported to the Division of Oil and Public Safety if
they are immediately contained and cleaned up. If cleanup cannot be accomplished within 24
hours, the Division of Oil and Public Safety must be notified immediately.
Spills or releases of hazardous substances in excess of the CERCLA reportable quantity from
regulated underground storage tanks must also be reported to the National Response Center and the
local fire authority immediately. Any release, regardless of quantity, that has or may impact waters
of the state (including surface water, groundwater, dry gullies leading to surface water or storm
sewers) must also be reported to the Colorado Environmental Release and Incident Reporting line
immediately.
These notification and reporting requirements are included in 7 CCR 1101-14 Article 4, 8-20.5-208
CRS and 25-8-601 CRS.
I. Hazardous Materials Transportation
Highway, Aircraft, Rail and Vessel
Federal hazardous materials transportation regulations cover the transportation of hazardous
materials by highway, aircraft, rail, and vessel. Transportation includes activities related to
transportation like loading, unloading, and temporary storage. "Hazardous material" includes
hazardous substances, hazardous wastes, marine pollutants, elevated temperature materials as
defined in 49 CFR Section 171.8, materials designated as hazardous in the Hazardous Materials
Table in 49 CFR Section 172.101 and materials that meet the criteria for hazardous classes and
division in 49 CFR Part 173.
The person in physical possession of the hazardous material during transportation must notify the
National Response Center as soon as practical, but not more than 12 hours after an incident, if as a
direct result of a hazardous material:
a person is killed or is injured and requires hospitalization,
there is an evacuation of the general public that lasts more than an hour,
a major transportation artery or facility is shut down for an hour or more,
the operational flight pattern or routine of an aircraft is altered,
there is fire, breakage, spillage, or suspected contamination involving a radioactive material,
there is fire, breakage, spillage, or suspected contamination involving an infectious
substance other than a regulated medical waste,
there is a release of a marine pollutant in a quantity exceeding 119 gallons for liquids or 882
pounds for solids,
or any situation that, in the judgment of the person in possession of the hazardous material,
should be reported even though it doesn't meet the above criteria.
Notice of incidents involving an infectious substance may be given to the Director of the Centers
for Disease Control and Prevention (1-800-232-0124) instead of notifying the National Response
Center.
12
Reporting Environmental Releases in Colorado January 2009
The person in possession of the hazardous material at the time of the incident must submit a written
report within 30 days of the incident to the US Department of Transportation. In addition, a written
report must be submitted if there is an unintentional release of a hazardous material or the discharge
of any quantity of hazardous waste even though verbal notification may not be required. If the
incident involves air transportation, a copy of the report must also be submitted to the Federal
Aviation Administration Security Field Office nearest the location of the incident.
These notification and reporting requirements are included in 49 CFR Sections 171.15 and 171.16.
State Requirements
The State also has specific requirements for reporting incidents involving hazardous materials or
nuclear materials as cargo during transportation. The driver of a motor vehicle involved in a spill of
hazardous material from a fuel tank that provides fuel for the vehicle and/or equipment on that
vehicle must immediately notify the nearest law enforcement agency. The driver of a vehicle
transporting nuclear or hazardous materials as cargo that is involved in a spill, or an incident which
may result in a potential spill, must immediately notify the nearest law enforcement agency. As
soon as possible after the initial notification of the spill or incident to the nearest law enforcement
agency, the driver or a company representative must notify the Colorado State Patrol and the 24-
hour Colorado Environmental Release and Incident Reporting Line. In addition, the driver of a
motor vehicle transporting nuclear materials as cargo must immediately notify the Colorado State
Patrol if the vehicle is involved in a crash, whether or not there is damage to the vehicle.
Report releases along a highway to the
National Response Center, nearest local
law enforcement agency, Colorado State
Patrol, and Colorado Environmental
Release and Incident Reporting Line.
If the incident involves the release of hazardous
waste, the transporter must notify the Colorado
Department of Public Health and Environment and
report the ultimate disposition of the waste to the
Department in addition to the notifications above. In
the event of a spill of hazardous waste at a transfer
facility, the transporter must notify the Colorado Department of Public Health and Environment
within 24 hours of a spill exceeding 55 gallons or if there is a fire or explosion. A written report
must be sent to the Department within 15 days after the incident.
These notification and reporting requirements are included in 8 CCR 1507-25 Parts I and IV and 6
CCR 1007-3 Part 263.
Pipelines
In Colorado, the US Department of Transportation Office of Pipeline Safety inspects, regulates, and
enforces interstate gas pipeline safety requirements. They also inspect, regulate, and enforce both
intra- and interstate liquid pipeline safety requirements in this state. Through certification by the
Office of Pipeline Safety, the Gas Pipeline Safety Division of the Colorado Public Utilities
Commission regulates, inspects, and enforces intrastate gas pipeline safety requirements. Pipeline
facilities include transmission, distribution, regulated gathering, master metered, liquefied natural
gas, and propane gas systems. Be aware that these regulations are primarily for pipeline safety. Be
sure to review other environmental release reporting requirements.
Hazardous Liquids and Carbon Dioxide
13
Reporting Environmental Releases in Colorado January 2009
Federal hazardous materials transportation regulations cover the transportation of hazardous liquids
and carbon dioxide by pipeline. In this case, hazardous liquid is limited to petroleum, petroleum
products, and anhydrous ammonia in a non-gaseous state. Petroleum includes crude oil,
condensate, natural gasoline, natural gas liquids, and liquefied petroleum gas. Petroleum product
includes flammable, toxic or corrosive products obtained from distilling and processing of crude oil,
unfinished oils, natural gas liquids, blend stocks, and other miscellaneous hydrocarbon compounds.
As early as practicable following discovery of a release of a hazardous liquid or carbon dioxide
from a pipeline system, the operator must notify the National Response Center by telephone if:
a person is killed or is injured and requires hospitalization,
there is a fire or explosion not intentionally set by the operator,
there is estimated property damage (including cost of cleanup and recovery, value of lost
product, and damage to property) exceeding $50,000,
there is pollution of any stream, river, reservoir, or other body of water that violated
applicable water quality standards, caused a discoloration of the surface of the water or
adjoining shoreline, or deposited a sludge or emulsion beneath the surface of the water or
adjoining shoreline, or
there is any situation that, in the judgment of the operator, should be reported even though it
doesn't meet the above criteria.
A written accident report must be submitted to the US Department of Transportation Office of
Pipeline Safety as soon as practicable, but not later than 30 days after discovery of a release. A
supplemental report must be submitted within 30 days if the operator receives any updates or
additions to the information originally reported.
These notification and reporting requirements are included in 49 CFR Part 195.
Natural Gas and Liquefied Natural Gas
Federal hazardous materials transportation regulations also cover the transportation of natural gas
by pipeline and activities occurring at a liquefied natural gas (LNG) facility where natural and
synthetic gas are liquefied, transferred or stored.
As early as practicable following discovery of a release of gas from a pipeline or of liquefied natural
gas or gas from a liquefied natural gas facility, but generally not to exceed two hours after
discovery, the operator must notify the National Response Center and the Colorado Public Utilities
Commission Gas Pipeline Safety Section by telephone if:
a person is killed or is injured and requires hospitalization,
there is estimated property damage (including value of lost product and damage to property)
of $50,000 or more,
there is an event that results in an emergency shutdown of a liquefied natural gas facility, or
there is any situation that, in the judgment of the operator, should be reported even though it
doesn't meet the above criteria.
As early as practicable, but not later than 30 days after discovery and verbal report of a release, the
operator must submit a written report to the US Department of Transportation Office of Pipeline
Safety. A supplemental report must be submitted within 30 days if the operator receives relevant
updates or additions to the information originally reported.
14
Reporting Environmental Releases in Colorado January 2009
These notification and reporting requirements are included in 49 CFR Part 191 and 4 CCR 723-4
Sections 4900 - 4914.
State Requirements
If there is a leak on a gas pipeline, a liquefied natural gas system, a master meter system, or a
propane system that results in the evacuation of 50 or more people from a normally occupied
building or results in the closure of a roadway, the operator must contact the Colorado Public
Utilities Commission Gas Pipeline Safety Section by telephone within two hours of discovery.
This notification requirement is contained in 4 CCR 723-4 Section 4911.
J. Oil and Gas Exploration and Production
Federal oil and gas lease surface operations are managed by the US Department of the Interior
Bureau of Land Management (BLM) in cooperation with the appropriate Federal surface
management agency or non-Federal surface owner. On National Forest System lands, the Forest
Service has approval authority for the surface use portion of Federal oil and gas operations and for
appeals related to Forest Service decisions and approvals. The BLM considers the Bureau of Indian
Affairs to be the surface management agency for all Indian lands unless a Tribe has contracted the
Bureau of Indian Affairs realty function for its lands.
“… All spills or leakages of oil, gas, salt water, toxic liquids or waste materials, blowouts, fires,
personal injuries, and fatalities shall be reported by the operator to the BLM and the surface
management agency in accordance with the requirements of Notice to Lessees NTL-3A; Reporting
of Undesirable Events, and in accordance with any applicable local requirements.
The BLM requires immediate reporting of all Class I major events, such as spills of more than 100
barrels of fluid/500 MCF of gas released; fires that consume 100 bbl or more oil or 500 MCF gas;
life threatening or fatal injury/loss of well control; release of reportable quantities of hazardous
substances; spill, venting, or fire in sensitive areas, such as parks, recreation sites, wildlife refuges,
lakes, reservoirs, streams, and urban or suburban areas” … “Volumes discharged during any of the
above incidents will be estimated as necessary. Operators must take immediate action to prevent
and control spills and the BLM, the surface management agency, and other applicable regulatory
authorities must be consulted prior to treating or disposing of wastes and spills. Operators should
become familiar with local surface management agency requirements for reporting and managing
spills and leaks. …” (BLM “The Gold Book,” Fourth Edition, Revised 2007)
State Requirements
Spills and releases of Exploration and Production (E&P) waste and produced fluids should be
controlled and contained immediately upon discovery. Impacts resulting from spills and releases
should be investigated and cleaned up as soon as practicable.
If there is a spill or release of more than 20 barrels of
E&P waste, it must be verbally reported to the Colorado
Oil and Gas Conservation Commission (COGCC) as soon
as practicable, but not more than 24 hours after discovery.
If there is a spill or release of any size that impacts or
The rules and regulations for oil and
gas exploration and production have
recently been revised. Most of these
changes become effective May 1,
2009 on federal land and April 1, 2009
on all other land.
15
Reporting Environmental Releases in Colorado January 2009
16
could impact waters of the state, a residence or an occupied structure, livestock or a public byway, it
must be verbally reported to the Colorado Oil and Gas Conservation Commission as soon as
practicable, but not more than 24 hours after discovery. Spills or releases of any size that impact or
threaten to impact any surface water supply area must be reported to the Colorado Oil and Gas
Conservation Commission and to the Colorado Environmental Release and Incident Reporting Line.
If the release impacts or threatens to impact a surface water intake, it must be verbally reported to
the emergency contact for that facility immediately after discovery. The operator must notify the
affected surface owner or their appointed tenant of all reportable spills as soon as practicable, but
not more than 24 hours after discovery.
Chemical spills and releases must be reported in accordance with all applicable state and federal
laws, including the Emergency Planning and community Right-to-Know Act (EPCRA), the
Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA), the Oil
Pollution Act, and the Clean Water Act.
Releases of more than 5 barrels of E&P waste, and all other reportable releases, must also be
reported on COGCC Form 19 and submitted to the Colorado Oil and Gas Conservation
Commission within 10 days after discovery of the release.
These notification requirements are contained in the Colorado Oil and Gas Conservation
Commission 900-Series Rules.
K. Polychlorinated Biphenyls
Polychlorinated biphenyls (PCBs) are managed under the Toxic Substances Control Act.
Substances with concentrations greater than or equal to 50 parts per million PCBs are regulated
under 40 CFR Part 761, which is implemented by the US Environmental Protection Agency. If a
spill of the substance directly contaminates surface water, sewers, drinking water supplies, grazing
lands, or vegetable gardens and/or the spill exceeds 10 pounds of PCBs by weight, the responsible
party must notify the EPA within 24 hours. In Colorado, contact the Region 8 Emergency Response
Spill Report Line. If the spill involves 10 pounds or less of PCBs and does not involve any of these
resources, the spill must still be cleaned up, but notification to EPA isn't required. Unless
commingled with a hazardous waste, releases of substances containing less than 50 parts per million
PCBs are regulated under Colorado's solid waste regulations 6 CCR 1007-2. The solid waste
regulations do not have specific release reporting requirements at this time.
The Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) has set
the reportable quantity for PCBs at one (1) pound. Any release of oil or other substance containing
greater than or equal to one pound of PCBs must be reported to the National Response Center as
soon as the release is discovered. In addition, if the release impacts waters of the state of Colorado,
the release must be reported as per the Water Quality Control Division’s reporting policy (see
“Guidance for Reporting Spills under the Colorado Water Quality Control Act and Colorado
Discharge Permits”, http://www.cdphe.state.co.us/op/wqcc/Resources/Guidance/spillguidance.pdf).
Reporting Environmental Releases in Colorado January 2009
Abbreviations & Definitions
CAA – Clean Air Act
CCR – Code of Colorado Regulations
CDPHE – Colorado Department of Public Health and Environment
CEPC – Colorado Emergency Planning Commission
CERCLA – Comprehensive Environmental Response, Compensation and Liability Act
CFR – Code of Federal Regulations
CRS – Colorado Revised Statues
CWA – Clean Water Act
EPA – United States Environmental Protection Agency
EPCRA – Emergency Planning and Community Right-to-Know Act
LEPC – Local Emergency Planning Committee
NRC – National Response Center
RCRA – Resource Conservation and Recovery Act
SERC – State Emergency Response Commission
SDWA – Safe Drinking Water Act
EPA's List of Lists is a compendium of the lists of chemicals subject to reporting requirements
under the Emergency Planning and Community Right-to-Know Act (EPCRA), the Comprehensive
Environmental Response, Compensation and Liability Act (CERCLA) and chemicals listed under
section 112(r) of the Clean Air Act (CAA). Lists are also provided of Resource Conservation and
Recovery Act (RCRA) hazardous wastes and radionuclides reportable under the Comprehensive
Environmental Response, Compensation and Liability Act. These lists should be used as reference
tools, not as a definitive source of compliance information. Reporting requirements for the
Emergency Planning and Community Right-to-Know Act and the Comprehensive Environmental
Response, Compensation and Liability Act are published in the Code of Federal Regulations (CFR),
40 CFR Parts 302 and 355 respectively. Compliance information for the Clean Air Act section
112(r) is published in 40 CFR Part 68. The List of Lists is available on the Internet at
http://yosemite.epa.gov/oswer/lol.nsf/homepage.
Exploration and production (E&P) wastes are associated with operations to locate or remove oil
or gas from the ground or to remove the impurities from oil or gas.
Extremely Hazardous Substances (EHS) are chemicals that present the most serious hazards
during release (in terms of toxicity, reactivity, volatility, combustibility, and flammability) and are
regulated under the Emergency Planning and Community Right-To-Know Act (EPCRA). The
extremely hazardous substances list consists of approximately 360 substances and is included in
EPA’s List of Lists.
Facility means any building, equipment, structure, installation, containment structure, pipe, other
stationary feature, motor vehicle, rolling stock, or aircraft. Facility also includes any site where a
hazardous substance is or has been located.
Hazardous Materials are chemicals posing a hazard to human health or the environment when
transported (49 USC 5103). They include hazardous substances, hazardous wastes, marine
pollutants, elevated temperature materials, all materials in the Hazardous Materials Table (49 CFR
172.101), and materials meeting the criteria for hazard classes in part 173 of subchapter C of 49
CFR 172.101.
17
Reporting Environmental Releases in Colorado January 2009
18
Hazardous Substances are chemicals posing a hazard to human health or the environment and are
regulated under the Comprehensive Environmental Response, Compensation and Liability Act
(CERCLA). The hazardous substance list is included in EPA’s List of Lists.
Reportable Quantity (RQ) is a term that applies to the amount of hazardous substances or
extremely hazardous substances released within a 24-hour period. Note that the 24-hour period is
the time frame for measuring the quantity released, not the time frame for reporting a release.
Threshold Planning Quantity (TPQ) is a term that applies to the amount of an extremely
hazardous substance that must be present onsite in concentrations greater than 1% by weight of a
compound or mixture at which the facility must meet all emergency planning requirements. If not
also listed as a CERCLA hazardous substance, extremely hazardous substances have a reportable
quantity equal to the threshold planning quantity for that substance.
“Waters of the State of Colorado” are any and all surface waters and subsurface waters
(groundwater) that are contained in or flow in or through the state of Colorado. This includes lakes,
rivers, streams, creeks, wetlands, irrigation ditches, storm drains, livestock ponds, borrow ditches,
and dry gullies. This does not include waters in sewage systems, waters in treatment works of
disposal systems, waters in potable water distribution systems, or water withdrawn for use until use
and treatment have been completed.
APPENDIX F
NRCS SOIL DATA
Hydrologic Soil Group—Larimer County Area, Colorado
Natural Resources
Conservation Service
Web Soil Survey
National Cooperative Soil Survey
3/15/2016
Page 1 of 4
4482230 4482310 4482390 4482470 4482550 4482630 4482710
4482230 4482310 4482390 4482470 4482550 4482630 4482710
496520 496600 496680 496760 496840 496920 497000 497080 497160 497240
496520 496600 496680 496760 496840 496920 497000 497080 497160 497240
40° 29' 42'' N
105° 2' 28'' W
40° 29' 42'' N
105° 1' 56'' W
40° 29' 26'' N
105° 2' 28'' W
40° 29' 26'' N
105° 1' 56'' W
N
Map projection: Web Mercator Corner coordinates: WGS84 Edge tics: UTM Zone 13N WGS84
0 150 300 600 900
Feet
0 50 100 200 300
Meters
Map Scale: 1:3,450 if printed on A landscape (11" x 8.5") sheet.
MAP LEGEND MAP INFORMATION
Area of Interest (AOI)
Area of Interest (AOI)
Soils
Soil Rating Polygons
A
A/D
B
B/D
C
C/D
D
Not rated or not available
Soil Rating Lines
A
A/D
B
B/D
C
C/D
D
Not rated or not available
Soil Rating Points
A
A/D
B
B/D
C
C/D
D
Not rated or not available
Water Features
Streams and Canals
Transportation
Rails
Interstate Highways
US Routes
Major Roads
Local Roads
Background
Aerial Photography
The soil surveys that comprise your AOI were mapped at 1:24,000.
Warning: Soil Map may not be valid at this scale.
Enlargement of maps beyond the scale of mapping can cause
misunderstanding of the detail of mapping and accuracy of soil line
placement. The maps do not show the small areas of contrasting
soils that could have been shown at a more detailed scale.
Please rely on the bar scale on each map sheet for map
measurements.
Source of Map: Natural Resources Conservation Service
Web Soil Survey URL: http://websoilsurvey.nrcs.usda.gov
Coordinate System: Web Mercator (EPSG:3857)
Maps from the Web Soil Survey are based on the Web Mercator
projection, which preserves direction and shape but distorts
distance and area. A projection that preserves area, such as the
Albers equal-area conic projection, should be used if more accurate
calculations of distance or area are required.
This product is generated from the USDA-NRCS certified data as of
the version date(s) listed below.
Soil Survey Area: Larimer County Area, Colorado
Hydrologic Soil Group
Hydrologic Soil Group— Summary by Map Unit — Larimer County Area, Colorado (CO644)
Map unit symbol Map unit name Rating Acres in AOI Percent of AOI
35 Fort Collins loam, 0 to 3
percent slopes
C 2.7 6.6%
36 Fort Collins loam, 3 to 5
percent slopes
B 21.7 52.2%
55 Kim loam, 5 to 9 percent
slopes
B 0.5 1.1%
63 Longmont clay, 0 to 3
percent slopes
D 0.3 0.8%
74 Nunn clay loam, 1 to 3
percent slopes
C 16.3 39.3%
Totals for Area of Interest 41.6 100.0%
Hydrologic Soil Group—Larimer County Area, Colorado
Natural Resources
Conservation Service
Web Soil Survey
National Cooperative Soil Survey
3/15/2016
Page 3 of 4
Description
Hydrologic soil groups are based on estimates of runoff potential. Soils are
assigned to one of four groups according to the rate of water infiltration when the
soils are not protected by vegetation, are thoroughly wet, and receive precipitation
from long-duration storms.
The soils in the United States are assigned to four groups (A, B, C, and D) and
three dual classes (A/D, B/D, and C/D). The groups are defined as follows:
Group A. Soils having a high infiltration rate (low runoff potential) when thoroughly
wet. These consist mainly of deep, well drained to excessively drained sands or
gravelly sands. These soils have a high rate of water transmission.
Group B. Soils having a moderate infiltration rate when thoroughly wet. These
consist chiefly of moderately deep or deep, moderately well drained or well drained
soils that have moderately fine texture to moderately coarse texture. These soils
have a moderate rate of water transmission.
Group C. Soils having a slow infiltration rate when thoroughly wet. These consist
chiefly of soils having a layer that impedes the downward movement of water or
soils of moderately fine texture or fine texture. These soils have a slow rate of water
transmission.
Group D. Soils having a very slow infiltration rate (high runoff potential) when
thoroughly wet. These consist chiefly of clays that have a high shrink-swell
potential, soils that have a high water table, soils that have a claypan or clay layer
at or near the surface, and soils that are shallow over nearly impervious material.
These soils have a very slow rate of water transmission.
If a soil is assigned to a dual hydrologic group (A/D, B/D, or C/D), the first letter is
for drained areas and the second is for undrained areas. Only the soils that in their
natural condition are in group D are assigned to dual classes.
Rating Options
Aggregation Method: Dominant Condition
Component Percent Cutoff: None Specified
Tie-break Rule: Higher
Hydrologic Soil Group—Larimer County Area, Colorado
Natural Resources
Conservation Service
Web Soil Survey
National Cooperative Soil Survey
3/15/2016
Page 4 of 4
APPENDIX G
EROSION CONTROL PLAN
Know what's
City of Fort Collins, Colorado
UTILITY PLAN APPROVAL
CityDate Engineer
WaterDate & Wastewater Utility
StormwaterDate Utility
ParksDate & Recreation
TrafficDate Engineer Date
EnvironmentalDate Planner
Date
Larimer County, Colorado
UTILITY PLAN APPROVAL
LarimerDate County Engineer
MAJESTIC DRIVE
ROCK CASTLE LANE
TRILBY ROAD
TIMBERLINE ROAD
City of Fort Collins, Colorado
UTILITY PLAN APPROVAL
CityDate Engineer
WaterDate & Wastewater Utility
StormwaterDate Utility
ParksDate & Recreation
TrafficDate Engineer Date
EnvironmentalDate Planner
Date
Larimer County, Colorado
UTILITY PLAN APPROVAL
LarimerDate County Engineer
City of Fort Collins, Colorado
UTILITY PLAN APPROVAL
CityDate Engineer
WaterDate & Wastewater Utility
StormwaterDate Utility
ParksDate & Recreation
TrafficDate Engineer Date
EnvironmentalDate Planner
Date
Larimer County, Colorado
UTILITY PLAN APPROVAL
LarimerDate County Engineer
City of Fort Collins, Colorado
UTILITY PLAN APPROVAL
CityDate Engineer
WaterDate & Wastewater Utility
StormwaterDate Utility
ParksDate & Recreation
TrafficDate Engineer Date
EnvironmentalDate Planner
Date
Larimer County, Colorado
UTILITY PLAN APPROVAL
LarimerDate County Engineer
Survey Area Data: Version 10, Sep 22, 2015
Soil map units are labeled (as space allows) for map scales 1:50,000
or larger.
Date(s) aerial images were photographed: Apr 22, 2011—Apr 28,
2011
The orthophoto or other base map on which the soil lines were
compiled and digitized probably differs from the background
imagery displayed on these maps. As a result, some minor shifting
of map unit boundaries may be evident.
Hydrologic Soil Group—Larimer County Area, Colorado
Natural Resources
Conservation Service
Web Soil Survey
National Cooperative Soil Survey
3/15/2016
Page 2 of 4
degrades into a CERCLA hazardous substance in an amount that equals or exceeds the reportable
quantity for the newly formed CERCLA hazardous substance.
2
GSRXMRYIH
&14W-R7;149WIH2SX2IIHIHEXXLMW8MQI8LMWWIGXMSRGERFIYWIHEWJSPPS[W
-JXLI&14MWVIUYMVIHF]XLI7;14ERHMQTPIQIRXIHMRHMGEXIF]TPEGMRKE MRFSXLXLIw-R7;14xERHw9WIHxGSPYQRW
-JXLI&14MWVIUYMVIHF]XLI7;14FYXRSXMQTPIQIRXIHMRHMGEXIF]TPEGMRKE MRXLIw-R7;14xERHw2SX2IIHIHEX
XLMW8MQIxGSPYQRW
E
)VSWMSR'SRXVSP&14W3R7MXI
)QFEROQIRX4VSXIGXSV
IKXIQTSVEV]WPSTIHVEMRWSTIRGLYXIHVEMRWIXG
+VEHMRK8IGLRMUYIW
IKZIVXMGEPXVEGOMRKWGEVMJ]MRKSVHMWOMRKXLIWYVJEGISRXLIGSRXSYVIXG
'LIGO(EQW
IKVSGOGLIGOIVSWMSRPSKWIVSWMSRFEPIWWMPXFIVQWIXG
3YXPIX4VSXIGXMSR
IKVMTVETIVSWMSRPSKEVSYRHXSTSJLIEH[EPPIXG
F
7IHMQIRX'SRXVSP&14W3R7MXI
-RPIX4VSXIGXMSR
IKIVSWMSRPSKWIVSWMSRFEPIWWERHFEKWKVEZIPFEKWIXG
4IVMQIXIV'SRXVSP
IKWMPXJIRGIIVSWMSRPSKWFIVQWIXG
H
1EXIVMEPW,ERHPMRK7TMPP4VIZIRXMSR;EWXI1EREKIQIRXERH+IRIVEP4SPPYXMSR4VIZIRXMSR
7XSGOTMPI1EREKIQIRX7XSGOTMPIWWLEPPFIPSGEXIHE[E]JVSQWIRWMXMZIEVIEW%PPIVSHMFPIWXSGOTMPIW
MRGPYHMRKXSTWSMP
WLEPP
FIGSRXEMRIHF]WMPXJIRGIFIVQWSVSXLIVWIHMQIRXGSRXVSPHIZMGIWXLVSYKLSYXGSRWXVYGXMSR
EPWSWIIWYFWIGXMSR
1EXIVMEPW1EREKIQIRX1EXIVMEPXLEXGSYPHGSRXVMFYXITSPPYXERXWXSWXSVQ[EXIVWLEPPLEZIWIGSRHEV]GSRXEMRQIRXSVSXLIV
IUYMZEPIRXTVSXIGXMSR
EPWSWIIWYFWIGXMSR
E
'SRGVIXI;EWXI1EREKIQIRX%PPGSRGVIXIVIWMHYIWLEPPFIGSRXEMRIHMREWMKRIHWXVYGXYVIEWHIWMKRIHTIVWYFWIGXMSR
N
ERHWYFWIGXMSR
R
-XWLEPPFIPSGEXIHEQMRMQYQSJJIIXJVSQWXEXI[EXIVW
7E[;EXIV'SRXEMRQIRX
IKTMGOYTFVSSQSVZEGYYQ
7XVIIX[EWLMRKMW EPPS[IH
7ERMXEV]*EGMPMX]8IQTSVEV]WERMXEV]JEGMPMXMIWWLEPPFIPSGEXIHJIIXE[E]JVSQHVEMREKI[E]WMRPIXWVIGIMZMRK[EXIVWERH
PSGEXIHE[E]JVSQEVIEWSJLMKLXVEJJMGERHEVIEWWYWGITXMFPIXSJPSSHMRKSVHEQEKIF]GSRWXVYGXMSRIUYMTQIRX
'SRWXVYGXMSR7MXI%WWIWWQIRX
'SVVIGXMZI%GXMSRW -RWTIGXXLIGSRWXVYGXMSRWMXIERHMRHMGEXI[LIVI&14JIEXYVI
W
MHIRXMJMIHMRWIGXMSR
&14W3R7MXIEX8MQISJ-RWTIGXMSR
VIUYMVIGSVVIGXMZIEGXMSR)VSWMSRERHWIHMQIRXGSRXVSPTVEGXMGIW
MHIRXMJMIHMRXLI7;14WLEPPFIIZEPYEXIHXSIRWYVIXLEXXLI]EVISTIVEXMRKGSVVIGXP]
0SGEXMSR7MXIPSGEXMSR
IKTVSNIGXWXEXMSRRYQFIVQMPIQEVOIVMRXIVWIGXMSRUYEHVERXIXG
&14-RHMGEXIXLIX]TISJ&14EXXLMWPSGEXMSRXLEXVIUYMVIWGSVVIGXMZIEGXMSR
IKWMPXJIRGIIVSWMSRPSKWWSMPVIXIRXMSR
FPEROIXWIXG
'SRHMXMSR-HIRXMJ]XLIGSRHMXMSRSJXLI&14YWMRKQSVIXLERSRIPIXXIV
MHIRXMJMIHMRWIGXMSR
MJRIGIWWEV]
(IWGVMTXMSRSJ'SVVIGXMZI%GXMSRERH4VIZIRXEXMZI1IEWYVI8EOIR4VSZMHIXLITVSTSWIHGSVVIGXMZIEGXMSRRIIHIHXSFVMRKXLI
EVIESV&14MRXSGSQTPMERGI3RGIGSVVIGXMZIEGXMSRWEVIGSQTPIXIHWXEXIXLIQIEWYVIWXEOIRXSTVIZIRXJYXYVIZMSPEXMSRWERH
IRWYVIXLEXXLI&14WEVISTIVEXMRKGSVVIGXP]MRGPYHMRKXLIVIUYMVIHGLERKIWQEHIXSXLI7;14
(EXI'SQTPIXIH
-RMXMEPW(EXIERHMRMXMEP[LIRXLIGSVVIGXMZIEGXMSR[EWGSQTPIXIHERHXLITVIZIRXEXMZIQIEWYVIWXEXIQIRX
JMRMWLIH
'SRWXVYGXMSR7MXI%WWIWWQIRX ;EWXLIVIER]SJJWMXIHMWGLEVKISJWIHMQIRXEXXLMWWMXIWMRGIXLIPEWXMRWTIGXMSR#
E
-WXLIVIIZMHIRGISJHMWGLEVKISJWIHMQIRXSVSXLIVTSPPYXERXWJVSQXLIWMXI#3JJWMXITSPPYXERXHMWGLEVKIWEVIEZMSPEXMSR
SJXLITIVQMX8LIGSRWXVYGXMSRWMXITIVMQIXIVEPPHMWXYVFIHEVIEWQEXIVMEPERHSV[EWXIWXSVEKIEVIEWXLEXEVII\TSWIHXS
TVIGMTMXEXMSRHMWGLEVKIPSGEXMSRWERHPSGEXMSRW[LIVIZILMGPIWEGGIWWXLIWMXIWLEPPFIMRWTIGXIHJSVIZMHIRGISJSVXLI
TSXIRXMEPJSVTSPPYXERXWPIEZMRKXLIGSRWXVYGXMSRWMXIFSYRHEVMIWIRXIVMRKXLIWXSVQ[EXIVHVEMREKIW]WXIQSVHMWGLEVKMRKXS
WXEXI[EXIV
F
,EWWIHMQIRXSVSXLIVTSPPYXERXWHMWGLEVKMRKJVSQXLIWMXIVIEGLIHWXEXI[EXIVW#3JJWMXITSPPYXERXHMWGLEVKIWEVIE
ZMSPEXMSRSJXLITIVQMX-JSJJWMXIHMWGLEVKILEWSGGYVVIHI\TPEMRXLIHMWGLEVKIERHXLIGSVVIGXMZIEGXMSRWMRWIGXMSR
'SRWXVYGXMSR7MXI%WWIWWQIRX
'SVVIGXMZI%GXMSRW
SVWIGXMSR
+IRIVEP2SXIW
+IRIVEP2SXIW -RHMGEXIER]EHHMXMSREPRSXIWXLEXEHHHIXEMPXSXLIMRWTIGXMSR XLMWQE]MRGPYHITSWMXMZITVEGXMGIWRSXIHSR
XLITVSNIGX
-RWTIGXMSR'IVXMJMGEXMSR -REGGSVHERGI[MXL4EVX-*GSJXLI'(477'4EPPVITSVXWJSVWYFQMXXEPWLEPPFIWMKRIHERH
GIVXMJMIHJSVEGGYVEG]
'SQTPMERGI'IVXMJMGEXMSR -REGGSVHERGI[MXL4EVX-(FZMMMSJXLI'(477'4GSQTPMERGIWLEPPFIGIVXMJMIHXLVSYKL
WMKREXYVI
TEKISJSVQ '(38*
4IVWYFWIGXMSRERH
'67
)VSWMSR'SRXVSP7YTIVZMWSV7;14%HQMRMWXVEXSV -RHMGEXIXLIREQISJXLIMRHMZMHYEPVIWTSRWMFPIJSVMQTPIQIRXMRK
QEMRXEMRMRKERHVIZMWMRKXLI7;14
'(384VSNIGX)RKMRIIV6ITVIWIRXEXMZI -RHMGEXIXLIREQISJXLI'(38VITVIWIRXEXMZITIVJSVQMRKXLIMRWTIGXMSR[MXLXLI
)'77;14%HQMRMWXVEXSV8LMWTIVWSRWLSYPHFIXLI4VSNIGX)RKMRIIVSVEREYXLSVM^IHVITVIWIRXEXMZI
'(477'4'IVXMJMGEXMSR -RHMGEXIXLI'SPSVEHS(MWGLEVKI4IVQMX7]WXIQ
'(47
7XSVQ[EXIV'SRWXVYGXMSR4IVQMX
7'4
JSV7XSVQ[EXIV(MWGLEVKIW%WWSGMEXIH[MXL'SRWXVYGXMSR%GXMZMXMIW
GIVXMJMGEXMSRRYQFIVMWWYIHF]'(4,)JSVXLITVSNIGX[LMGL
XLIVITSVXMWFIMRKGSQTPIXIH'IVXMJMGEXMSRRYQFIVGERFIJSYRHSRXLIJMVWXTEKISJXLI7'4
6IEWSR
W
JSV-RWTIGXMSR)\GPYWMSR -RHMGEXIXLITYVTSWIJSVXLIMRWTIGXMSRSVI\GPYWMSR8LIWIMRWTIGXMSRWEVI
VIUYMVIHXSGSQTP][MXLXLI'(387TIGMJMGEXMSRWERHXLI'(477'4
6SYXMRI-RWTIGXMSRW8LIWIMRWTIGXMSRWEVIVIUYMVIHEXPIEWXIZIV]GEPIRHEVHE]WHYVMRKEGXMZIGSRWXVYGXMSR7YWTIRHIH
TVSNIGXWVIUYMVIXLIGEPIRHEVHE]MRWTIGXMSRYRPIWWWRS[GSZIVI\MWXWSZIVXLIIRXMVIWMXIJSVERI\XIRHIHTIVMSHSJXMQIERH
QIPXMRKGSRHMXMSRWHSRSXI\MWX
WII;MRXIV'SRHMXMSRW-RWTIGXMSRW)\GPYWMSRW
6YRSJJ)ZIRX-RWTIGXMSRJSV%GXMZI7MXIW7IITEKIJSVHIJMRMXMSR
8LMVH4EVX]6IUYIWX-RHMGEXIXLIREQISJXLIXLMVHTEVX]VIUYIWXMRKXLIMRWTIGXMSRERHMJORS[RXLIVIEWSRXLIVIUYIWX[EW
QEHI
;MRXIV'SRHMXMSRW-RWTIGXMSRW)\GPYWMSRW7IITEKIJSVHIJMRMXMSR%RMRWTIGXMSRHSIWRSXRIIHXSFIGSQTPIXIHFYXYWI
XLMWJSVQXSHSGYQIRXXLIGSRHMXMSRWXLEXQIIXXLI)\GPYWMSR
3XLIV7TIGMJ]ER]SXLIVVIEWSR
W
XLEXVIWYPXIHMRXLIMRWTIGXMSR
7;141EREKIQIRX 6IZMI[XLI7;14VIGSVHWERHHSGYQIRXWERHYWIE XSERW[IVXLIUYIWXMSR8SGSQTP][MXL
'(387XERHEVH7TIGMJMGEXMSRWERHXLI'(477'4EPPSJXLIMXIQWMHIRXMJMIHQYWXFIEHLIVIHXS-J2SMWGLIGOIHHSGYQIRXXLI
VIEWSRERHMRHMGEXIXLIRIGIWWEV]GSVVIGXMZIEGXMSRMRWIGXMSR
'SRWXVYGXMSR7MXI%WWIWWQIRX
'SVVIGXMZI%GXMSRW
-J2%MW
GLIGOIHMRHMGEXI[L]MRXLIWTEGITVSZMHIHSVMRHMGEXIMRWIGXMSR
+IRIVEP2SXIW
E
-WXLI7;14RSXIFSSOPSGEXIHSRWMXI#%GST]SJXLI7;14RSXIFSSOQYWXFIVIXEMRIHSRWMXIYRPIWWERSXLIVPSGEXMSR
WTIGMJMIHF]XLITIVQMXMWETTVSZIHF]XLI(MZMWMSR
F
%VIGLERKIWXSXLI7;14HSGYQIRXWRSXIHERHETTVSZIH#-RHMGEXIEPPGLERKIWXLEXLEZIFIIRQEHIXSER]TSVXMSRSJXLI
7;14RSXIFSSOHSGYQIRXWHYVMRKGSRWXVYGXMSR'LERKIWWLEPPFIHEXIHERHWMKRIHEXXLIXMQISJSGGYVVIRGI%QIRHQIRXW
QE]MRGPYHIMXIQWPMWXIHMRWYFWIGXMSR
G
G
%VIXLIMRWTIGXMSRVITSVXWVIXEMRIHMRXLI7;14RSXIFSSO#8LI)'7)RKMRIIVWLEPPOIITEVIGSVHSJMRWTIGXMSRW
-RWTIGXMSRVITSVXWQYWXMHIRXMJ]ER]MRGMHIRXWSJRSRGSQTPMERGI[MXLXLIXIVQWERHGSRHMXMSRWSJXLI'(38WTIGMJMGEXMSRWSVXLI
'(477'4-RWTIGXMSRVIGSVHWQYWXFIVIXEMRIHJSVXLVII]IEVWJVSQI\TMVEXMSRSVMREGXMZEXMSRSJTIVQMXGSZIVEKI
H
%VIGSVVIGXMZIEGXMSRWJVSQXLIPEWXMRWTIGXMSRGSQTPIXIH#,EZIGSVVIGXMZIEGXMSRWJVSQXLIPEWXMRWTIGXMSRFIIREHHVIWWIH#
-WEHIWGVMTXMSRSJXLIGSVVIGXMZIEGXMSR
W
XLIHEXI
W
SJXLIGSVVIGXMZIEGXMSR
W
ERHXLIQIEWYVI
W
XEOIRXSTVIZIRXJYXYVI
ZMSPEXMSRW
MRGPYHMRKGLERKIWXSXLI7;14EWRIGIWWEV]
HSGYQIRXIH#
I
-WE7TMPP4VIZIRXMSR'SRXVSPERH'SYRXIVQIEWYVI
74''
4PERVIXEMRIHMRXLI7;14RSXIFSSO#7YFWIGXMSR
G
VIUYMVIWXLEXE74''TPERFIHIZIPSTIHERHMQTPIQIRXIHXSIWXEFPMWLSTIVEXMRKTVSGIHYVIWERHXLEXXLIRIGIWWEV]IQTPS]II
XVEMRMRKFITVSZMHIHXSQMRMQM^IEGGMHIRXEPVIPIEWIWSJTSPPYXERXWXLEXGERGSRXEQMREXIWXSVQ[EXIVVYRSJJ6IGSVHWSJWTMPPW
PIEOWSVSZIVJPS[WXLEXVIWYPXMRXLIHMWGLEVKISJTSPPYXERXWQYWXFIHSGYQIRXIHERHQEMRXEMRIH-RJSVQEXMSRXLEXWLSYPHFI
VIGSVHIHJSVEPPSGGYVVIRGIWMRGPYHIXLIXMQIERHHEXI[IEXLIVGSRHMXMSRWVIEWSRWJSVWTMPPIXG7SQIWTMPPWQE]RIIHXSFI
VITSVXIHXSXLI;EXIV5YEPMX]'SRXVSP(MZMWMSRMQQIHMEXIP]
J
-WEPMWXSJTSXIRXMEPTSPPYXERXWVIXEMRIHEXXLIWMXI#7YFWIGXMSR
F
VIUYMVIWXLI)VSWMSR'SRXVSP7YTIVZMWSVXSMHIRXMJ]
ERHHIWGVMFIEPPTSXIRXMEPTSPPYXERXWSYVGIWMRGPYHMRKQEXIVMEPWERHEGXMZMXMIWERHIZEPYEXIXLIQJSVXLITSXIRXMEPXSGSRXVMFYXI
TSPPYXERXWXSWXSVQ[EXIVHMWGLEVKI
'YVVIRX'SRWXVYGXMSR%GXMZMXMIW 4VSZMHIEWLSVXHIWGVMTXMSRSJXLIGYVVIRXGSRWXVYGXMSREGXMZMXMIWTLEWIEXXLITVSNIGXWMXI
MRGPYHIWYQQEV]SJKVEHMRKEGXMZMXMIWMRWXEPPEXMSRSJYXMPMXMIWTEZMRKI\GEZEXMSRPERHWGETMRKIXG
)WXMQEXIXLIEGVIWSJHMWXYVFIHEVIEEXXLIXMQISJXLIMRWTIGXMSR-RGPYHIGPIEVMRKKVEHMRKI\GEZEXMSREGXMZMXMIWEVIEW
VIGIMZMRKSZIVFYVHIR
IKWXSGOTMPIW
HIQSPMXMSREVIEWERHEVIEW[MXLLIEZ]IUYMTQIRXZILMGPIXVEJJMGMRWXEPPEXMSRSJRI[SV
MQTVSZIHLEYPVSEHWERHEGGIWWVSEHWWXEKMRKEVIEWFSVVS[EVIEWERHWXSVEKIXLEX[MPPHMWXYVFI\MWXMRKZIKIXEXMZIGSZIV
&14W3R7MXIEX8MQISJ-RWTIGXMSR -RHMGEXIXLI&14WXLEXEVIMRWXEPPIHSRWMXIEXXLIXMQISJMRWTIGXMSR%PP&14
HIXEMPW
IK7XERHEVH4PER1
WLEPPFIMRGPYHIH[MXLXLI7;14HSGYQIRXW
TEKISJSVQ '(38*
QMRMQYQIZIV] 'EPIRHEV(E]W
6YRSJJ)ZIRX
4SWXWXSVQIZIRXMRWTIGXMSRWQYWXFIGSRHYGXIH[MXLMRLSYVWEJXIVXLIIRHSJER]TVIGMTMXEXMSRSVWRS[QIPXIZIRXXLEXGEYWIW
WYVJEGIIVSWMSR-JRSGSRWXVYGXMSREGXMZMXMIW[MPPSGGYVJSPPS[MRKEWXSVQIZIRXTSWXWXSVQIZIRXMRWTIGXMSRWWLEPPFIGSRHYGXIHTVMSVXSVIGSQQIRGMRK
GSRWXVYGXMSREGXMZMXMIWFYXRSPEXIVXLERLSYVWJSPPS[MRKXLIWXSVQIZIRX8LISGGYVVIRGISJER]WYGLHIPE]IHMRWTIGXMSRQYWXFIHSGYQIRXIHMRXLI
MRWTIGXMSRVIGSVH
6SYXMRIMRWTIGXMSRWWXMPPQYWXFIGSRHYGXIHIZIV]GEPIRHEVHE]W
%TTVS\MQEXI)RH8MQISJ7XSVQ
LVW
8LMVH4EVX]6IUYIWX
;MRXIV'SRHMXMSRW-RWTIGXMSRW)\GPYWMSR -RWTIGXMSRWEVIRSXVIUYMVIHEXWMXIW[LIVIGSRWXVYGXMSREGXMZMXMIWEVIXIQTSVEVMP]LEPXIHWRS[GSZIV
I\MWXWSZIVXLIIRXMVI WMXIJSVERI\XIRHIHTIVMSHERHQIPXMRKGSRHMXMSRWTSWMRKEVMWOSJWYVJEGIIVSWMSRHSRSXI\MWX8LMWI\GITXMSRMWETTPMGEFPI
SRP]HYVMRKXLITIVMSH[LIVIQIPXMRKGSRHMXMSRWHSRSXI\MWXERHETTPMIWXSXLIVSYXMRIHE]MRWTIGXMSRWEW[IPPEWXLITSWXWXSVQIZIRXMRWTIGXMSRW
-JZMWYEPMRWTIGXMSRSJXLIWMXIZIVMJMIWXLEXEPPSJXLIWIGSRHMXMSRWEVIWEXMWJMIHHSGYQIRXXLIGSRHMXMSRWMRWIGXMSR
+IRIVEP2SXIW
ERHTVSGIIHXS
WIGXMSR
-RWTIGXMSR'IVXMJMGEXMSR
(SGYQIRXEXMSRQYWXMRGPYHI HEXIW[LIRWRS[GSZIVSGGYVVIHHEXI[LIRGSRWXVYGXMSREGXMZMXMIWGIEWIHERHHEXI
[LIRQIPXMRKGSRHMXMSRWFIKER
3XLIV
7XSVQ7XEVX(EXI
)WXMQEXISJHMWXYVFIHEVIEEXXLIXMQISJ
XLIMRWTIGXMSR CCCCCCC%GVIW
E
-WXLI7;14RSXIFSSOPSGEXIHSRWMXI#
F
%VIGLERKIWXSXLI7;14HSGYQIRXWRSXIHERHETTVSZIH#
G
%VIXLIMRWTIGXMSRVITSVXWVIXEMRIHMRXLI7;14RSXIFSSO#
H
%VIGSVVIGXMZIEGXMSRWJVSQXLIPEWXMRWTIGXMSRGSQTPIXIH#
I
-WE7TMPP4VIZIRXMSR'SRXVSPERH'SYRXIVQIEWYVI4PERVIXEMRIH
EXXLITVSNIGXWMXI#
J
-WEPMWXSJTSXIRXMEPTSPPYXERXWVIXEMRIHEXXLIWMXI#
7;141%2%+)1)28
'966)28'327869'8-32%'8-:-8-)7
=IW 2S 2%
&14W327-8)%88-1)3*-274)'8-327II-RWTIGXMSR6ITSVX-RWXVYGXMSRWJSVQSVIHIXEMP
-R7;14 9WIH 2SX2IIHIH
EXXLMWXMQI
-R7;14 9WIH 2SX2IIHIH
EXXLMWXMQI
E
)637-32'328630&14W327-8)
F
7)(-1)28'328630&14W327-8)
7IIHMRK
1YPGLMRK1YPGL8EGOMJMIV
7SMP&MRHIV
7SMP6IXIRXMSR&PEROIXW
)QFEROQIRX4VSXIGXSV
+VEHMRK8IGLRMUYIW
&IVQ(MZIVWMSR
'LIGO(EQW
3YXPIX4VSXIGXMSR
3XLIV
G
&14W*3674)'-%0'32(-8-327
(I[EXIVMRK7XVYGXYVI
8IQT7XVIEQ'VSWWMRK
'PIEV;EXIV(MZIVWMSR
7IRWMXMZI%VIE*IRGMRK
3XLIV
7XEFMPM^IH'SRWX)RXVERGI
7IHMQIRX8VET
-RPIX4VSXIGXMSR
7IHMQIRX&EWMR
4IVMQIXIV'SRXVSP
3XLIV
H
1%8)6-%07,%2(0-2+74-0046):)28-32;%78)
1%2%+)1)28%2(+)2)6%0430098-3246):)28-32
7XSGOTMPI1EREKIQIRX
1EXIVMEPW1EREKIQIRX
'SRGVIXI;EWXI1EREKIQIRX
7E[;EXIV1EREKIQIRX
7SPMH;EWXI8VEWL1EREKIQIRX
7XVIIX7[IITMRK
7ERMXEV]*EGMPMX]
:ILMGPIERH)UYMT1EREKIQIRX
3XLIV
TEKISJSVQ '(38*
4VSNIGX2EQI
'(384VSNIGX2YQFIV
4VSNIGX'SHI
7YF%GGSYRX
'(38
6IKMSR
4VSNIGX'SRXVEGXSV
)VSWMSR'SRXVSP7YTIVZMWSV7;14%HQMRMWXVEXSV
'(477'4'IVXMJMGEXMSR
'(384VSNIGX)RKMRIIV6ITVIWIRXEXMZI
-RWTIGXSV
W
2EQIERH8MXPI
(EXISJ4VSNIGX-RWTIGXMSR
;IEXLIVEX8MQISJ-RWTIGXMSR
development, the permittee may need to rely on BMPs implemented by an entity in charge of the larger development, such as
street sweeping, inlet protection, or a water quality detention pond that treats runoff from several different lots. In such
situations, the BMPs implemented by the other party must be fully addressed by the permittee‘s SWMP, and written
OR Not applicable (site has not been subdivided)
SW Construction Application for: page 3 of 5
City: Zip Code: County: