Loading...
HomeMy WebLinkAboutARROWHEAD COTTAGES - MJA/FDP - FDP160004 - REPORTS - STORMWATER MANAGEMENT PLANSTORMWATER MANAGEMENT PLAN (SWMP) ARROWHEAD COTTAGES Fort Collins, CO June 3, 2016 Prepared for: Landmark Construction Solutions 1170 W. Ash Street #100 Windsor, CO 80550 970-330-4316 Prepared by: 301 N. Howes Street, Unit 100 Fort Collins, Colorado 80521 Phone: 970.221.4158 www.northernengineering.com Project Number: 374-018  This Drainage Report is consciously provided as a PDF. Please consider the environment before printing this document in its entirety. When a hard copy is absolutely necessary, we recommend double-sided printing. 301 N. Howes Street, Suite 100, Fort Collins, CO 80521 970.221.4158 www.northernengineering.com June 3, 2016 Landmark Construction Solutions 1170 W. Ash Street #100 Windsor, CO 80550 RE: Stormwater Management Plan Arrowhead Cottages Replat of Centre Avenue Residences To Whom It May Concern: Northern Engineering Services, Inc. is pleased to submit this Stormwater Management Plan for Arrowhead Cottages. This report outlines Best Management Practices (BMPs) to be implemented with the proposed construction in order to minimize potential pollutants in stormwater discharges. We have prepared this report to accompany the Colorado Department of Public Health and Environment General Permit for Stormwater Discharge Associated with Construction Activities (aka, Stormwater Discharge Permit or SDP). The General Permit No. for this SDP is (to be filled-in by permittee) and the Certification No. for this SDP is (to be filled-in by permittee). The Permit Certification is Effective beginning (to be filled-in by permittee), and initial certification expires (to be filled-in by permittee). A copy of the issuance cover letter can be found in the Appendix D of this document (to be provided by permittee). Please note: this Stormwater Management plan (including the Site Maps) is not a static document. It is a dynamic device that should be kept current and logged as construction takes place. As such, this version was prepared to facilitate initial plan approvals and permitting, but does not necessarily reflect the final version, or the transitions throughout the construction process. As the site develops and changes, the Contractor is expected and encouraged to make changes to what is contained herein so that the SWMP works as effectively and efficiently as possible. It shall be the responsibility of the SWMP Administrator and/or the permit holder (or applicant thereof) to ensure the plan is properly maintained and followed. If you should have any questions or comments as you review this report, please feel free to contact us at your convenience. Sincerely, NORTHERN ENGINEERING SERVICES, INC. Danny Weber, PE Arrowhead Cottages Stormwater Management Plan TABLE OF CONTENTS Vicinity Map 1.0 General Requirements ................................................................................................ 1 1.1 Objectives .................................................................................................................. 1 1.2 SMWP Availability ...................................................................................................... 1 1.3 Definitions.................................................................................................................. 1 1.4 Additional Permitting ................................................................................................... 1 2.0 Narrative Site Description ........................................................................................... 2 2.1 Existing Site Description .............................................................................................. 2 2.2 Nature of Construction Activity ..................................................................................... 2 2.3 Sequence of Major Activities ......................................................................................... 2 2.4 Site Disturbance ......................................................................................................... 3 2.5 Existing Data .............................................................................................................. 3 2.6 Existing Vegetation ...................................................................................................... 3 2.7 Potential Pollution Sources ........................................................................................... 3 2.8 Non-stormwater discharges .......................................................................................... 4 2.9 Receiving Waters ........................................................................................................ 4 3.0 Stormwater Management Controls ............................................................................... 4 3.1 SWMP Administrator ................................................................................................... 4 3.2 Best Management Practices (BMP’s) for Stormwater Pollution Prevention.......................... 5 3.3 Structural Practices for Erosion and Sediment Control ..................................................... 5 3.4 Non-Structural Practices for Erosion and Sediment Control .............................................. 7 3.5 Phased BMP Installation .............................................................................................. 9 3.6 Material Handling and Spill Prevention ........................................................................ 10 3.7 Dedicated Concrete or Asphalt Batch Plant .................................................................. 10 3.8 Vehicle Tracking Control ............................................................................................ 11 3.9 Waste Management and Disposal ............................................................................... 11 3.10 Groundwater and Stormwater Dewatering .................................................................... 11 4.0 Final Stabilization and Long-Term Stormwater Management ........................................ 11 4.1 Final Stabilization ..................................................................................................... 11 4.2 Long-Term Stormwater Management ........................................................................... 12 5.0 Inspection, Maintenance and Record Keeping ............................................................. 12 5.1 BMP Inspection ........................................................................................................ 12 5.2 BMP Maintenance .................................................................................................... 12 5.3 Record Keeping ........................................................................................................ 12 6.0 Additional SWMP and BMP Resources ....................................................................... 14 References 15 Arrowhead Cottages Stormwater Management Plan APPENDICES: APPENDIX A – Site Maps APPENDIX B – Erosion Control Details APPENDIX C – Landscape Plan APPENDIX D – Copies of Permits/Applications APPENDIX E – Inspection Logs APPENDIX F – Erosion Control Escrow Estimate APPENDIX G – Contractor Inserts (as needed) Arrowhead Cottages Stormwater Management Plan 1 1.0 General Requirements 1.1 Objectives The objective of a Stormwater Management Plan (SWMP) is to identify all potential sources of pollution likely to occur as a result of construction activity associated with the site construction, and to describe the practices that will be used to reduce the pollutants in stormwater discharges from the site. The SWMP must be completed and implemented at the time the project breaks ground, and revised as necessary as construction proceeds to accurately reflect the conditions and practices at the site. This report summarizes the Stormwater Management Plan for the construction activity that will occur with Arrowhead Cottages in Fort Collins, CO. This plan has been prepared according to regulations of the Colorado Department of Public Health and Environment (CDPHE), Water Quality Control Division. 1.2 SMWP Availability This report is intended to remain on the aforementioned construction site to allow for maintenance and inspection updates, and for review during inspection. 1.3 Definitions BMP – Best Management Practice encompassing a wide range of erosion and sediment control practices, both structural and non-structural in nature, which are intended to reduce or eliminate any possible water quality impacts from stormwater leaving a construction site. Erosion Control BMPs – Practices that PREVENT the erosion of soil, such as minimizing the amount of disturbed area through phasing, temporary stabilization, and preserving existing vegetation. Sediment Control BMP’s – Practices to REMOVE sediment from runoff, such as sediment basins, silt fence, or inlet protection. Non-structural BMP’s – The implementation of methods, practices, and procedures to minimize water quality impacts, such as the preservation of natural vegetation, preventive maintenance and spill response procedures. Structural BMP’s – Physical devices that prevent or minimize water quality impacts, such as sediment basins, inlet protection, or silt fence. 1.4 Additional Permitting As mentioned above, this Stormwater Management Plan is associated with the Colorado Department of Public Health and Environment Stormwater Permit issued by the Water Quality Control Division of the Colorado Department of Public Health and Environment (CDPHE). Additional Environmental permitting not described in this report may be required as a part of this project. An example is the Construction Dewatering Permit for groundwater. Another example is the Air Pollution Emission Notice (APEN). The CDPHE website contains links to both of these permits, as well as many other potential permits. The Contractor is responsible for ensuring the proper permits are acquired. CDPHE Construction Permit Website: http://www.colorado.gov/cs/Satellite/CDPHE-WQ/CBON/1251596875260 Arrowhead Cottages Stormwater Management Plan 2 2.0 Narrative Site Description 2.1 Existing Site Description Arrowhead Cottages is a replat of Centre Avenue Residences, located in Section 23, Township 7 North, Range 69 West of the 6th P.M., City of Fort Collins, County of Larimer, State of Colorado. The site is partially developed with an existing multi-story apartment complex, parking and detention pond. The remaining site is comprised of mostly vacant land with bare soils, natural grasses and vegetation. Bounded to the north by the New Mercer Ditch, to the west by Worthington Circle, to the south by Centre Avenue, and to the east by an existing commercial development. 2.2 Wind and Rainfall Erodibility According to the Natural Resources Conservation Service website -www.websoilsurvey.nrcs.usda.gov, the applicable Wind Erodibility Group (WEG), which indicates the susceptibility to wind erosion in cultivated areas, is 6. This value is indicative of soils moderately to highly susceptible to wind erosion. Additionally, the applicable soil erosion factor (K), which indicates the susceptibility of a soil to sheet and rill erosion, is 0.28 to 0.32. This value is indicative of soils moderately susceptible to rainfall erosion. Impervious area (i.e., roof area, concrete walks and asphalt/paver parking area) and landscaping will permanently stabilize the areas disturbed by the proposed construction activity; therefore, the likelihood of erosion and sediment problems occurring on-site is minimal. During the interim period, in which the disturbed areas are open, the BMPs described herein were selected to prevent erosion and limit sediment migration. 2.3 Nature of Construction Activity The proposed project site plan is composed of Multi-Family Housing (condos). This site will employ many water quality features and runoff reduction facilities including porous pavers, bio-retention ponds (rain gardens), and bio-swales. The installation of proposed utilities (e.g., electric, gas, sanitary sewer, domestic water and storm drain) will occur next. While building foundations are being constructed, concrete curbs will be installed around the proposed parking areas. A permeable paver section within the access drives will likely follow completion of exterior construction. The fine grading of the landscaped areas and the installation of landscaping will mark the completion of the construction activities. 2.4 Sequence of Major Activities To complete the project, many basic categories of construction activity will take place. The first part of the project will consist of overlot grading. Within this phase, protection will need to be supplied to the existing streets and inlets, as well as other perimeter protection. With the surroundings, type of perimeter protection will vary due to the differing types of ground material. It will be the Contractor’s responsibility to implement the appropriate measure to suit the installation and type of ground material. This will be followed by utility installation and foundation excavation. Vertical construction of the Multi-Family Housing will commence after foundation and underground work is complete. New curb/gutter, paving, and sidewalks are expected to begin after the building is dried in and tradecrafts move inside. Installation of the permeable paver system is likely to occur at this time. The final stages of site construction will be fine grading of the areas around the buildings, and the installation of landscaping throughout the project. The aforementioned sequencing is an initial best guess, and is subject to change at the Contractor’s discretion. Arrowhead Cottages Stormwater Management Plan 3 2.5 Site Disturbance The site disturbance will occur in and off of the project property is approximately 1.06 acres. Grading of the entire site is expected in order to reach final grades. 2.6 Existing Data In order to complete the associated construction plans, a topographical survey of the site was completed. This survey consisted of field measurements made by Northern Engineering Services on October 2008 and March 2009. In addition to the field survey, a geotechnical report was used to determine existing soil types found on-site. According to the report by Earth Engineering Consultants dated October 13, 2008 lists the soils for the area as consisting of layers of sandy lean clay (CL) and clayey sand (SC). These soils are classified as Hydrologic Soil Group C and have a low infiltration rate. 2.7 Existing Vegetation The existing site is comprised of an existing multi-family dwelling, associated parking, and detention pond with the remainder mostly vacant land with bare soils, natural grasses and vegetation. The approximate percent existing vegetative cover is 50%. It is highly recommended that pre- construction photos be taken to clearly document vegetative conditions prior to any disturbance activities. 2.8 Potential Pollution Sources As is typical with most construction sites, there are a number of potential pollution sources which could affect water quality. It is not possible for this report to identify all materials that will be used or stored on the construction site. It is the sole responsibility of the Contractor to identify and properly handle all materials that are potential pollution sources. The following are some common examples of potential pollution sources: • Exposed and stored soils • Management of contaminated soils • Off-site tracking of soils and sediment • Loading and unloading operations • Outdoor storage of building materials, fertilizers, chemicals, etc. • Vehicle and equipment maintenance and fueling • Significant dust or particulate generating processes • Routine maintenance activities involving fertilizers, pesticides, detergents, fuels, solvents, oils, etc. • On-site waste disposal practices (waste piles, dumpsters, etc.) • Concrete truck/equipment washing • Non-industrial waste sources that may be significant, such as worker trash and portable toilets • Uncovered trash bins • Other areas or procedures where potential spills can occur • Stockpiling of materials that can be transported to receiving waterway(s) Management of Contaminated Soils: We are not aware of on-site contaminated soils. However, the contractor should conduct a thorough, pre-construction environmental site assessment. If contaminated soils are discovered, the contractor will identify appropriate practices and procedures for the specific contaminants discovered on-site. Arrowhead Cottages Stormwater Management Plan 4 Loading and Unloading Operations: During site demolition, material loading and unloading will occur on-site. As site development and building construction progresses, space constraints will limit the number of on-site locations for loading and unloading activities to the site. The contractor will be responsible for the proper handling and management of traffic control and pollution sources during loading and unloading operations. Dedicated Asphalt and Concrete Batch Plants: Neither a dedicated asphalt or concrete batch plant will be constructed on-site. 2.9 Non-stormwater discharges The Stormwater Construction Permit only covers discharges composed entirely of stormwater. Emergency firefighting water is the only authorized exception. Concrete Washout water can NOT be discharged to surface waters or to storm sewer systems without separate permit coverage. The discharge of Concrete Washout water to the ground, under specific conditions, may be allowed by the Stormwater Construction Permit when appropriate BMPs are implemented. The discharge of pumped stormwater, ONLY, from excavations, ponds, depressions, etc. to surface waters, or to a municipal storm sewer system is allowed by the Stormwater Construction Permit, as long as the dewatering activity and associated BMPs are identified in the Stormwater Management Plan (SWMP) and are implemented in accordance with the SWMP. Aside from the exceptions noted above, non-stormwater discharges must be addressed in a separate permit issued for that discharge. If groundwater is encountered, and dewatering is required, a Construction Dewatering Permit must be acquired from the Colorado Department of Public Health and Environment. 2.10 Receiving Waters The northern portion of the site sheet drains to an existing on-site detention pond designed and constructed during the Centre Avenue Residences development plan. The detention pond has established vegetation and no construction activities are planned in this area. This detention pond outfalls to a storm sewer system located under Centre Avenue. The southern portion of the site sheet drains to an existing inlet located at the northeast corner of Centre Avenue and Worthington Circle where flows are routed east. A small area sheet drains to the eastern curb and gutter of Worthington Circle where flows are directed north to an inlet that discharges back into the existing on-site detention pond. 3.0 Stormwater Management Controls 3.1 SWMP Administrator A SWMP Administrator must be designated in conjunction with the Stormwater Permit. This person shall be responsible for developing, implementing, maintaining, and revising the SWMP. The SWMP Administrator will also be the contact for all SWMP-related issues and will be the person responsible for the accuracy, completeness, and implementation of the SWMP. The Administrator should be a person with authority to adequately manage and direct day-to-day stormwater quality management activities at the site. Arrowhead Cottages Stormwater Management Plan 5 The SWMP Administrator for this site is: Name: (to be filled-in by permittee) Company: (to be filled-in by permittee) Phone: (to be filled-in by permittee) E-mail: (to be filled-in by permittee) 3.2 Best Management Practices (BMP’s) for Stormwater Pollution Prevention Beginning from mobilization, and throughout the entire construction of the project, erosion control devices shall be installed to ensure minimal pollutant migration. These erosion control devices may be installed in phases, or not at all, depending on actual conditions encountered at the site. It is the responsibility of the Contractor to make the determination as to what practices should be employed and when. In the event that a review agency deems BMPs to be insufficient, it shall be the responsibility of the contractor to implement modifications as directed. Best Management Practices (BMPs) are loosely defined as a method, activity, maintenance procedure, or other management practice for reducing the amount of pollution entering a water body. The term originated from rules and regulations in Section 208 of the Clean Water Act. Details for Structural and Non-Structural BMPs have been included in Appendix B. These details should be used for additional information on installation and maintenance of BMPs specified in this report. It is also intended to serve as a resource for additional BMPs that may be appropriate for the site that have not specifically been mentioned in the report. 3.3 Structural Practices for Erosion and Sediment Control Structural BMPs are physical devices that are implemented to prevent erosion from happening or to limit erosion once it occurs. These devices can be temporary or permanent, and installation of individual components will vary depending on the stage of construction. A table depicting construction sequence and BMP application/removal has been placed on the “Dynamic Site Plan” to help document the implementation of these BMPs. Refer to the Stormwater Management Plan Static Site Plan in the Appendix for the assumed location of all BMPs. Construction Details for Temporary BMPs are located in the Appendix for reference. Again, the final determination for which BMP’s will be installed, where they will be located, and when they will be installed shall be made by the Contractor, along with all documentation throughout the construction process. Silt Fencing (Phase I) Silt fencing shall be provided to prevent migration of sediment off-site or into adjacent properties. All silt fencing shall be installed prior to any land disturbing activity (demolition, stockpiling, stripping, grading, etc.). Silt fencing is to be installed prior to site excavation or earthwork activities. Inspections of the silt fence should identify tears or holes in the material, and should check for slumping fence or undercut areas that allow flows to bypass the fencing. Damaged sections of fencing should be repaired or replaced to ensure proper functioning. Sediment accumulated behind the silt fence should be removed to maintain BMP effectiveness, typically before it reaches a depth of 6 inches. At a minimum, it is suggested that silt fencing shall be located along the northern and southern Arrowhead Cottages Stormwater Management Plan 6 limits of disturbance. Silt fencing can be installed in conjunction with/adjacent to construction or security fencing. Sediment Control Logs may also be substituted in lieu of silt fencing, as appropriate. See below for a description of Sediment Control Logs. Sediment Control Log – aka “Straw Wattles” (Phase I) A Sediment Control Log is a linear roll made of natural materials, such as straw, coconut fiber, or other fibrous material trenched into the ground and held with a wooden stake. Sediment Control Logs can be used in many instances. Examples include perimeter control for stockpiles, as part of inlet protection designs, as check dams in small drainage ways, on disturbed slopes to shorten flow lengths, or in lieu of silt fencing (where appropriate). Sediment Control Logs should be inspected for excess sediment accumulation. Sediment should be removed prior to reaching half the height of the log. At a minimum, Sediment Control Logs should be used around soil stockpiles (including landscape material), drainage swales, and at all stormwater discharge locations other than inlets. Vehicle Tracking Control Pads (Phase I) Vehicle tracking control pads shall be provided to minimize tracking of mud and sediment onto paved surfaces and neighboring roadways. All vehicle tracking control pads shall be installed prior to any land disturbing activity (demolition – as necessary, stockpiling, stripping, grading, etc.). Location of vehicle tracking control pads will be located at any and all existing and future vehicle accesses being used during any of the construction phases. These locations will primarily be dictated by gates or openings in the temporary construction fencing that is expected to be installed. Vehicle tracking control pads are to be installed prior to demolition (as appropriate), site excavation or earthwork activities. Vehicle tracking pads should be inspected for degradation and aggregate material should be replaced as needed. If the area becomes clogged with water, excess sediment should be removed. Aggregate material should remain rough, and at no point should aggregate be allowed to compact in a manner that causes the tracking pad to stop working as intended. Suggested locations for a vehicle tracking pad is at the proposed access to the site from Centre Avenue. Inlet Protection (Phase I & II) Inlet protection shall be provided for existing inlets to prevent sediment transport from adjacent earthwork disturbance. Installation of these filters shall occur before adjacent earth disturbing activities (Phase I implementation). Wattle type filters are to be implemented for new and existing inlets where asphalt does not exist. For these inlets, if pavement is constructed adjacent to the structure or if the area adjacent to the inlet is changed such that the wattle type filter is no longer effective, it shall be the responsibility of the Contractor to ensure that an appropriate method is used instead. For example, the wattle filter could be reused, or a gravel-block inlet filter may be installed. It will be left to the discretion of the Contractor as to whether replacement of any inlet filter is necessary. Inlet protection should be inspected regularly for tears that can result in sediment entering an inlet. Inlet protection should also be inspected for sediment accumulation upstream of the inlet, and sediment should be removed when the less than half of the capacity is available, or per manufacturer specifications. The Contractor shall provide inlet protection for all proposed inlets as they are installed (Phase II Arrowhead Cottages Stormwater Management Plan 7 implementation) and at all existing inlets adjacent the site on Centre Avenue and Worthington Circle (Phase I). Concrete Washout Area (Phase II-III) A concrete washout should be provided on the site. The washout can be lined or unlined excavated pits in the ground, commercially manufactured prefabricated containers, or aboveground holding areas. The concrete washout must be located a minimum of 400 feet from any natural drainage way or body of water, and at least 1000 feet from any wells or drinking water sources. Washout areas should not be located in an area where shallow groundwater may be present. Contractor shall clearly show the desired location and access to the Concrete Washout Area on the Stormwater Management Plan - Dynamic Site Plan. Contractor shall place a Vehicle Tracking Pad if the selected location for the Concrete Washout Area is detached from pavement. Clear signage identifying the concrete washout should also be provided. The Concrete Washout Area should be inspected regularly. Particular attention should be paid to signage to ensure that the area is clearly marked. Confirmation that the washout is being used should also be noted to ensure that other undesignated areas of the site are not being used incorrectly as a concrete washout. An appropriate location for the concrete washout area is located interior to the site, away from discharge points. This location is a suggestion only, and can be relocated at the discretion of the Contractor. Permanent/Established Vegetation (Phase IV) Permanent or established vegetation and landscaping is considered a permanent form of sediment and erosion control for common open spaces, steep slopes and areas not exposed to prolonged scour velocities, or acute incipient motion bed shear stresses that will create soil erosion, rill formation and subsequent sediment transport. Areas where the previous conditions apply will contain sufficient permanent BMPs, such as riprap or cobble mulch. Permanent vegetation shall conform to an approved Landscaping Plan. 3.4 Non-Structural Practices for Erosion and Sediment Control Non-Structural BMPs are practices or activities that are implemented to prevent erosion from happening or to limit erosion once it occurs. These BMPs can be a practice resulting in physical change to the site, such as mulching or slope stabilization. They can also result in behavioral changes on the site, such as changes to construction phasing to minimize exposure to weather elements, or increased employee awareness gained through training. Protection of Existing Vegetation (Phases I-IV) Protection of existing vegetation on a construction site can be accomplished through installation of a construction fence around the area requiring protection. In cases where up-gradient areas are disturbed, it may also be necessary to install perimeter controls to minimize sediment loading to sensitive areas such as wetlands. Trees that are to remain after construction is complete must be protected. Most tree roots grow within the top 12”-18” of soil, and soil compaction is a significant threat to tree health. As such, particular care should be taken to avoid activities within the drip-line of the tree. Direct equipment damage should also be prevented. The most effective way to ensure the health of trees is to establish a protection zone at the drip-line of the tree to prevent unintended activity in the area directly surrounding the tree. Fencing should be inspected and repaired when needed. If damage occurs to a tree, an arborist Arrowhead Cottages Stormwater Management Plan 8 should be consulted on how to care for the tree. If a tree is damage beyond repair, the City Forester should be consulted on remediation measures. No existing vegetation is expected to be preserved with this development. Stockpile Management (Phases I-IV) Stockpile management should be utilized to minimize erosion and sediment transport from soil stockpiles. In general, soil stockpiles should be located a minimum of 100 feet from any drainage way and 50 feet from any storm sewer inlets. Where practical, choose a stockpile location that will remain undisturbed for the longest period of time as the phases of construction progress. Sediment control BMPs should be placed around the perimeter of the stockpile, and a designated access point on the upstream side of the stockpile should be identified. BMPs such as surface roughening, temporary seeding, mulching, erosion control blankets, or soil binders should be used to stabilize the stockpile surface. As a part of stockpile management, regular inspections of the perimeter controls should be completed. If BMPs have been utilized to stabilize the surface of the stockpile, they should be inspected and repaired as needed. While significant soil stockpiles are not expected with this project, it is possible that foundation excavation or the delivery landscaping material may generate temporary stockpiles. The location of any such stockpiles shall be the responsibility of the SWMP Administrator. Mulching (Phase I-IV) Mulching helps reduce erosion by protecting bare soil from rainfall impact, increasing infiltration, and reducing runoff. Although often applied in conjunction with temporary or permanent seeding, it can also be used for temporary stabilization of areas that cannot be reseeded due to seasonal constraints. The most common type of mulch used is hay or grass that is crimped into the soil to keep it secure. However, crimping may not be practical on slopes steeper than three to one (3H:1V). The Contractor shall mulch all planted areas within twenty-four (24) hours after planting. Only weed-free and seed-free straw mulch may be used. Straw mulch should be applied at two (2) tons per acre, and shall be adequately secured by crimping, tackifier, netting or blankets. Hydraulic mulching may also be used on steep slopes or where access is limited. In the case that hydraulic mulching is utilized, the Contractor shall use wood cellulose fibers mixed with water at two thousand to two thousand five hundred (2,000-2,500) pounds per acre and organic tackifier at one hundred to four hundred (100-400) pounds per acre. Wind Erosion/Dust Control (Phase I-IV) Wind Erosion and Dust Control BMP’s help to keep soil particles from entering the air as a result of land disturbing construction activities. Examples include use of a water truck or irrigation/sprinkler system to wet the top layer of disturbed soil, seeding and mulching, soil binders, or wind fences. If a water truck or irrigation/sprinkler system is utilized, monitoring to ensure that sufficient water is applied is crucial to ensuring soil particles don’t become airborne. Equally important is monitoring for overwatering, as too much water can lead to increased erosion. Street Sweeping (Phases I -IV) Street sweeping should be used to remove sediment that has been tracked onto adjacent roadways. Roadways should be inspected at least once a day, and sediment should be removed as needed. A check of the area inlet protection should be completed after sweeping to ensure nothing was displaced during sweeping operations. Street sweeping can reduce the sediment washed into the Arrowhead Cottages Stormwater Management Plan 9 existing storm drain system. Street sweeping may be necessary on the existing hardscape areas which receive runoff from the disturbed areas. Saw Cutting Pollution Prevention (Phase I) The following protocol is recommended to prevent dust and slurry from asphalt and concrete saw cutting activities from migrating into the existing storm drain system. • Slurry and cuttings shall be vacuumed during cutting and surfacing operations • Slurry and cuttings shall not remain on permanent concrete or asphalt pavement overnight • Slurry and cuttings shall not drain to any natural or constructed drainage conveyance • Collected slurry and cuttings shall be disposed of in a manner that does not violate groundwater or surface water standards Good Housekeeping Practices (All phases) Good housekeeping practices that will prevent pollution associated with solid, liquid, and hazardous construction-related materials and wastes should be implemented throughout the project. Examples of good housekeeping include providing an appropriate location for waste management containers, establishing proper building material staging areas, designating paint and concrete washout areas, establishing proper equipment/vehicle fueling and maintenance practices. Development of a spill prevention and response plan is another example of Good Housekeeping practices that should be used on the project. The following items are detailed examples of some of the good housekeeping practices that should be utilized throughout the project. It should be noted that a complete list of practices and detailed discussion regarding good housekeeping has been included with Appendix B, sheets GH-1 – GH-6. Street Sweeping and Vacuuming – Street sweeping and vacuuming should be used to remove sediment that has been tracked onto adjacent roadways. Roadways should be inspected at least once a day, and sediment should be removed as needed. A check of inlet protection should be completed after sweeping to ensure nothing was displaced during sweeping operations. Waste Management – Designate trash and bulk waste collection areas on-site. When possible, materials should be recycled. Hazardous material waste should be segregated from other solid waste. Waste collection areas should be located away from streets, gutters, watercourses, and storm drains. Dumpsters should be located near site entrances to minimize traffic on disturbed soils, and they should be placed on a level soil surface. Establish Proper Building Material Handling and Staging areas – Clearly designate site areas for staging and storage of building materials. Provide appropriate BMPs to ensure that spills or leaks are contained. Establish Proper Equipment/Vehicle Fueling and Maintenance Practices – If needed, create a clearly designated on-site fueling and maintenance area that is clean and dry. Provide appropriate BMPs to ensure that spills or leaks are contained. 3.5 Phased BMP Installation It is important to recognize the four (4) major Development Phases as defined by the State of Colorado’s Stormwater Discharge Permit (SDP). These four development phases (referred to as Sequencing by the City of Fort Collins) have been distinguished to aid in the appropriate timing of installation/implementation of BMPs at different stages of the construction process. These phases are described as follows: Arrowhead Cottages Stormwater Management Plan 10 Phase I – Grading Stage; BMPs for initial installation of perimeter controls Phase II – Infrastructure Stage; BMPs for utility, paving and curb installation Phase III – Vertical Construction Stage; BMPs for individual building construction. Phase IV – Permanent BMPs and final site stabilization. Included in the back map pockets are Site Plans: a “Static” Site Plan and “Dynamic” Site Plans. The “Static” plan serves to display the overall management plan all at once. However, proper implementation of BMPs does not occur at once, and certain BMPs may move location in the construction process; therefore, the “Dynamic” Site Plans are intended for the Contractor to write in the BMP symbols to document the location and time the BMPs are installed and maintained throughout the entire construction process. 3.6 Material Handling and Spill Prevention Potential pollution sources, as discussed in earlier sections, are to be to be identified by the Contractor. Spill prevention procedures are to be determined and put in place prior to construction by the Contractor. A spill and flooding response procedure must also be determined and put in place prior to construction by the Contractor. Additionally, steps should be taken to reduce the potential for leaks and spills to come in contact with stormwater runoff, such as storing and handling toxic materials in covered areas or by storing chemicals within berms or other secondary containment devices. A notification procedure must be put in place by the Contractor, by which workers would first notify the site construction superintendent, who would then notify the SWMP Administrator. Depending on the severity of the spill, the site construction superintendent and SWMP Administrator would possibly notify the Colorado Department of Public Health and Environment - Water Quality Control Division, downstream water users, or other appropriate agencies. The release of any chemical, oil, petroleum product, sewage, etc., which enter waters of the State of Colorado (which include surface water, ground water, and dry gullies or storm sewers leading to surface water) must be reported immediately to the Division’s emergency spill reporting line at (877) 518-5608. All spills that will require cleanup, even if the spill is minor and does not need to be reported to the state, should still be reported to the City of Fort Collins Utilities office at 970-221-6700. While not expected with this project, it will be the responsibility of the Contractor to designate a fueling area and take the necessary precautions to ensure that no stormwater pollution occurs in the event that a fueling area is needed. Fueling areas shall be located a minimum 100 feet from all drainage courses. A 12-inch high compacted earthen ridge capable of retaining potential spills shall enclose fueling areas. Other secondary containment devices can be used instead of the earthen ridge. The area shall be covered with a non-porous lining to prevent soil contamination. Printed instructions for cleanup procedures shall be posted in the fueling area and appropriate fuel absorbents shall be available along with containers for used absorbents within the fueling area. 3.7 Dedicated Concrete or Asphalt Batch Plant There are not any dedicated concrete or asphalt batch plants anticipated with this project. In the event that a plant is needed, the Contractor should be aware that additional permitting will be required. In particular, an Air Pollutant Emission Notice (APEN) will need to be obtained from the CDPHE. Arrowhead Cottages Stormwater Management Plan 11 3.8 Vehicle Tracking Control In addition to the vehicle tracking pads discussed previously, additional measures can be taken to minimize and control sediment discharges from the site due to vehicle tracking. These measures can include fencing around the site to control access points. Regular street sweeping can also be used to minimize the transmission of sediment from the site due to vehicles leaving the site. The use of gravel parking areas and wash racks can also be implemented to ensure minimal vehicle tracking from the site. 3.9 Waste Management and Disposal It will be the responsibility of the Contractor to designate a concrete truck chute washout area and to clearly identify that area. Detailed information about the design and maintenance of the Concrete Washout can be found under the Structural Practices section of this report. At no time should untreated wash water be allowed to discharge from the site or to enter a storm drain system or stream. Upon completion of construction activities the concrete washout material shall be removed and properly disposed of prior to the area being restored. Any waste material that currently exists on the site or that is generated by construction will be disposed of in such a manner as to not cause pollutants in stormwater discharges. If waste is to be stored on-site, it shall be in an area located a minimum of 100 feet from all drainage courses. Whenever waste is not stored in a non-porous container, it shall be in an area enclosed by a 12- inch high compacted earthen ridge or some other approved secondary containment device. The area shall be covered with a non-porous lining to prevent soil contamination. Whenever precipitation is predicted, the waste shall be covered with a non-porous cover, anchored on all sides to prevent its removal by wind, in order to prevent precipitation from leaching out potential pollutants from the waste. On-site waste disposal practices, such as dumpsters, should be covered or otherwise contained as to prevent dispersion of waste materials from wind. It shall also be the responsibility of the Contractor to maintain a clean jobsite as to prevent dispersion of waste material and potential pollutants into adjacent properties or waterways. The location of, and protective measures for, temporary restroom facilities shall be the responsibility of the SWMP Administrator. 3.10 Groundwater and Stormwater Dewatering The BMPs selected for construction dewatering vary depending on the site-specific features, such as soils, topography, discharge quantities, and discharge location. Typically, dewatering involves pumping water from an inundated area to a BMP, prior to the water being released downstream into a receiving waterway, sediment basin, or well-vegetated area. Acceptable BMPs included discharging water into a sediment trap or basin, using a dewatering filter bag, or using a series of sediment logs. A settlement tank or an active treatment system can also be utilized. Another commonly used method to handle the pumped water is the “sprinkler method,” which involves applying the water to vegetated areas through a perforated discharge hose. Dispersal from a water truck for dust control can also be used to disperse the pumped water. 4.0 Final Stabilization and Long-Term Stormwater Management 4.1 Final Stabilization All disturbed areas will be seeded, crimped and mulched or sod in accordance to an approved Landscaping Plan. As defined by the Colorado Department of Public Health and Environment in the General Permit Application for Stormwater Discharges, “Final stabilization is reached when all soil disturbing activities at the site have been completed, and uniform vegetative cover has been Arrowhead Cottages Stormwater Management Plan 12 established with a density of at least 70 percent of pre-disturbance levels or equivalent permanent, physical erosion reduction methods have been employed.” 4.2 Long-Term Stormwater Management The method of long-term stormwater management will take place within the paver section before being discharged into the Dixon Canyon Lateral. All disturbed areas will receive permanent paving or will be vegetated per and approved Landscaping Plan. 5.0 Inspection, Maintenance and Record Keeping 5.1 BMP Inspection All temporary erosion control facilities shall be inspected at a minimum of once every two (2) weeks and after each significant storm event or snowmelt. Repairs or reconstruction of BMPs, as necessary, shall occur as soon as possible in order to ensure the continued performance of their intended function. It is the responsibility of the SWMP Administrator to conduct bi-weekly inspections, maintain BMPs if needed, to keep records of site conditions and inspections, and to update the SWMP as necessary. The construction site perimeter, disturbed areas, all applicable/installed erosion and sediment control measures, and areas used for material storage that are exposed to precipitation shall be inspected for evidence of, or the potential for, pollutants entering the drainage system. Erosion and sediment control measures identified in the SWMP shall be observed to ensure that they are operating correctly. Particular attention should be paid to areas that have a significant potential for stormwater pollution, such as demolition areas, concrete washout locations, and vehicle entries to the site. The inspection must be documented to ensure compliance with the permit requirements. 5.2 BMP Maintenance Any BMP’s not operating in accordance with the SWMP must be addressed as soon as possible, immediately in most cases, to prevent the discharge of pollutants. If modifications are necessary, such modifications shall be documented so that the SWMP accurately reflects on-site conditions. The SWMP needs to accurately represent field conditions at all times. Uncontrolled releases of mud, muddy water, or measurable amounts of sediment found off-site will be recorded with a brief explanation of the measures taken to clean-up the sediment that has left the site, as well as the measures taken to prevent future releases. This record shall be made available to the appropriate public agencies (Colorado Department of Public Health and Environment, Water Quality Control Division; Environmental Protection Agency; City of Fort Collins; etc.) upon request. Preventative maintenance of all temporary and permanent erosion control BMPs shall be provided in order to ensure the continued performance of their intended function. Temporary erosion control measures are to be removed after the site has been sufficiently stabilized as determined by the City of Fort Collins. Maintenance activities and actions to correct problems shall be noted and recorded during inspections. Inspection and maintenance procedures specific to each BMP identified with this SWMP are discussed in Section 3. Details have also been included with Appendix B. 5.3 Record Keeping Documentation of site inspections must be maintained. The following items are to be recorded and kept with the SWMP: Arrowhead Cottages Stormwater Management Plan 13 • Date of Inspection • Name(s) and title(s) of personnel making the inspection • Location(s) of sediment discharges or other pollutants from the site • Location(s) of BMP’s that need to be maintained • Location(s) of BMP’s that failed to operate as designed or proved inadequate • Locations(s) where additional BMP’s are needed that were not in place at the time of inspection • Deviations from the minimum inspection schedule • Descriptions of corrective action taken to remedy deficiencies that have been identified • The report shall contain a signed statement indicating the site is in compliance with the permit to the best of the signer’s knowledge and belief after corrective actions have been taken. Provided within Appendix E of this SWMP is an Example Inspection Log to aid in the record keeping of BMP inspections and maintenance. Photographs, field notebooks, drawings and maps should be included by the SWMP Administrator when appropriate. In addition to the Inspection Log, records should be kept documenting: • BMP maintenance and operation • Stormwater contamination • Contacts with suppliers • Notes on the need for and performance of preventive maintenance and other repairs • Implementation of specific items in the SWMP • Training events (given or attended) • Events involving materials handling and storage • Contacts with regulatory agencies and personnel • Notes of employee activities, contact, notifications, etc. Records of spills, leaks, or overflows that result in the discharge of pollutants must be documented and maintained. A record of other spills that are responded to, even if they do not result in a discharge of pollutants, should be made. Information that should be recorded for all occurrences includes the time and date, weather conditions, reasons for the spill, etc. Some spills may need to be reported to authorities immediately. Specifically, a release of any chemical, oil, petroleum product, sewage, etc., which may enter waters of the State of Colorado (which include surface water, ground water and dry gullies or storm sewers leading to surface water) must be reported to the CDPHE. Additionally, the “Dynamic Site Plan” is intended to be a “living” document where the SWMP Administrator can hand write the location of BMPs as they are installed to appropriately reflect the current site conditions. Also on the “Dynamic Site Plan” is a “Table of Construction Sequence and BMP Application/Removal” that the SWMP Administrator can use to document when BMPs were installed or removed in conjunction with construction activities. These items have been included as an aid to the SWMP Administrator, and other methods of record keeping are at his or her discretion. This Stormwater Management Plan (both the text and map) is not a static document. It is a dynamic device intended to be kept current and logged as construction takes place. It shall be the responsibility of the SWMP Administrator and/or the permit holder (or applicant thereof) to ensure the plan is properly maintained and followed. Diligent administration is critical, including processing the Notice to Proceed and noting on the Stormwater Management Plan the dates that various construction activities occur and respective BMPs are installed and/or removed. Arrowhead Cottages Stormwater Management Plan 14 6.0 Additional SWMP and BMP Resources Urban Drainage and Flood Control District Urban Storm Drainage Criteria Manual - Volume 3 “Best Management Practices” Website: http://www.udfcd.org/downloads/down_critmanual_volIII.htm Colorado Department of Transportation Erosion Control and Stormwater Quality Guide BMP Field Academy Website: http://www.coloradodot.info/programs/environmental/water-quality/documents/erosion-storm-quality EPA Menu of BMP’s Construction Site Storm Water Runoff Control Website: http://water.epa.gov/polwaste/npdes/swbmp/Construction-Site-Stormwater-Run-Off-Control.cfm International Stormwater Best Management (BMP) Database Rocky Mountain Education Center Website: http://www.bmpdatabase.org/ Rocky Mountain Education Center Red Rocks Community College, Lakewood Website: http://www.rmecosha.com/ Keep It Clean Partnership Boulder Website: http://www.keepitcleanpartnership.org/ Arrowhead Cottages Stormwater Management Plan 15 References 1. Final Drainage and Erosion Control Report for Centre Avenue Residences, Northern Engineering Services, October 13, 2009 (NE Project No. 110-034) 2. Soil Resource Report for Larimer County Area, Colorado, Natural Resources Conservation Service, United States Department of Agriculture. 3. Urban Storm Drainage Criteria Manual, Volumes 1-3, Urban Drainage and Flood Control District, Water Resources Publications, LLC., Denver, Colorado, Updated November 2010. APPENDIX A SITE MAPS UD UD UD UD UD UD UD UD ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST H Y D VAULT ELEC VAULT ELEC V.P. ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST C ONTROL IRR VAULT ELEC CONTROL IRR ST UD UD UD UD UD UD UD UD ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST H Y D VAULT ELEC VAULT ELEC V.P. ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST C ONTROL IRR VAULT ELEC CONTROL IRR ST APPENDIX B EROSION CONTROL DETAILS A A PLAN VIEW SECTION A-A Sheet Of 16 Sheets ARROWHEAD COTTAGES These drawings are instruments of service provided by Northern Engineering Services, Inc. and are not to be used for any type of construction unless signed and sealed by a Professional Engineer in the employ of Northern Engineering Services, Inc. NOT FOR CONSTRUCTION REVIEW SET 200 South College Avenue, Suite 010 Fort Collins, Colorado 80524 ENGINEER ING N O R T H E RN PHONE: 970.221.4158 FAX: 970.221.4159 www.northernengineering.com EC2 EROSION CONTROL DETAILS CALL UTILITY NOTIFICATION CENTER OF COLORADO Know what'sbelow. Call before you dig. R City Engineer Date Date Date Date Date Stormwater Utility Parks & Recreation Traffic Engineer Date Water & Wastewater Utility City of Fort Collins, Colorado UTILITY PLAN APPROVAL Environmental Planner VEHICLE TRACKING CONTROL PAD SHALL BE LOCATED AT EVERY ACCESS POINT TO THE CONSTRUCTION SITE. A SIGN SHALL BE PLACED NEXT TO THE VEHICLE TRACKING CONTROL PAD TO DESIGNATE THE LOCATION AS THE CONSTRUCTION ENTRANCE/EXIT. VEHICLE TRACKING CONTROL (VTC) PADS SHALL CONSIST OF HARD, DENSE, DURABLE ROCK, ANGULAR IN SHAPE AND RESISTANT TO WEATHERING. ROUNDED STONE SHALL NOT BE USED, i.e., RIVER ROCK AND COBBLES. THE ROCK SHALL BE A MINIMUM OF 3" AND A MAXIMUM OF 6" DIAMETER. THE ROCK SHALL HAVE A SPECIFIC GRAVITY OF AT LEAST 2.6. CONTROL OF GRADATION WILL BE BY VISUAL INSPECTION. NOTE: OTHER MATERIALS, i.e., ROADBASE, MUD MATS, ETC., MAY BE USED IN PLACE OF ROCK UPON WRITTEN APPROVAL OF THE CITY INSPECTOR. ANY CRACKED OR DAMAGED CURB AND GUTTER AND SIDEWALK SHALL BE REPLACED BY CONTRACTOR. INSTALLATION NOTES: 1. 2. 3. 4. CONTRACTOR SHALL INSPECT VEHICLE TRACKING CONTROL PAD DAILY. ROCK SURFACE SHALL BE CLEAN AND LOOSE ENOUGH TO RUT SLIGHTLY UNDER WHEEL LOADS AND CAUSE LOOSE ROCK TO DISLODGE MUD FROM TIRES. WHEN ROCK BECOMES COMPACTED OR FILLED WITH SEDIMENT SO THAT THE EFFECTIVENESS OF THE PAD IS DIMINISHED, CONTRACTOR SHALL RIP, TURN OVER, OR OTHERWISE LOOSEN ROCK, PLACE ADDITIONAL NEW ROCK, OR REPLACE WITH NEW ROCK AS NECESSARY TO RESTORE EFFECTIVENESS. SEDIMENT AND OTHER MATERIAL SPILLED, DROPPED OR TRACKED ONTO PAVED SURFACES SHALL BE REMOVED IMMEDIATELY OR BY THE END OF EACH WORKING APPENDIX C LANDSCAPE PLAN MDJ BSP CBS UD UD UD UD UD UD UD UD UD UD UD UD VAULT ELEC S WV T T T T T T T T T T T G G G G G G G G G G G G G G G G G G G G G G G G G G G T T T T T T T T T T T T T T T T APPENDIX D COPIES OF PERMITS/APPLICATIONS APPENDIX E INSPECTION LOGS '3036%(3()4%681)283*86%274368%8-32 (%-0=78361;%8)603+ -REGGSVHERGI[MXLWYFWIGXMSR 7XSVQ[EXIV1EREKIQIRX*MIPH(EMP]-RWTIGXMSR6ITSVX-RWXVYGXMSRW -RWTIGXEPPIVSWMSRERHWIHMQIRXGSRXVSP&14WXLVSYKLSYXXLIIRXMVIGSRWXVYGXMSRWMXIzSFWIVZIVIGSVHERHHIXIVQMRIXLIMV IJJIGXMZIRIWW-JEHHMXMSREP&14WEVIRIIHIHSVER]&14MWRSXSTIVEXMRKIJJIGXMZIP]MXWLEPPFIVIGSVHIHSRXLMWJSVQERH EHHVIWWIHMQQIHMEXIP] 6IGSVHXLIWMXIPSGEXMSR '3036%(3()4%681)283*86%274368%8-32 (%-0=78361;%8)603+%((-8-32%04%+) (EXI 4VSNIGXRYQFIV 7YFEGGSYRXRYQFIV 8LIIRXMVIWMXIWLEPPFIMRWTIGXIHXSHIXIVQMRI[LIXLIV&14WEVIFIMRKMQTPIQIRXIHERHQEMRXEMRIHMREGGSVHERGI[MXLXLI TVSNIGXvWWMXIWTIGMJMG7;14ERHXLI'(477'48LI)VSWMSR'SRXVSP7YTIVZMWSV APPENDIX F EROSION CONTROL ESCROW ESTIMATE Project: Disturbed Acres: 1.06 EROSION CONTROL BMPs Units Estimated Quantity Unit Price Total Price L.F. 620 $1.85 $1,147.00 each 4 $220.00 $880.00 each 10 $300.00 $3,000.00 each 1 $500.00 $500.00 each 1 $400.00 $400.00 each 4 $25.00 $100.00 each 1 $1,200.00 $1,200.00 L.F. 225 $0.50 $112.50 per hour 30 $70.00 $2,100.00 Sub-Total: $9,439.50 1.5 x Sub-Total: $14,159.25 Amount of security: $14,159.25 Total Acres x Price/acre: $893.05 $842.50 Sub-Total: $893.05 1.5 x Sub-Total: $1,339.58 Amount to Re-seed: $1,339.58 Minimum escrow amount: $3,000.00 Erosion Control Escrow: $14,159.25 Miniumum Escrow Amount Final Escrow Amount “The amount of the security must be based on one and one-half times the estimate of the cost to install the approved measures, or one and one-half times the cost to re-vegetate the disturbed land to dry land grasses based upon unit cost determined by the City's Annual Revegetation and Stabilization Bid, whichever is greater. In no instance, will the amount of security be less than one thousand five hundred dollars ($1,500) for residential development or three thousand dollars ($3,000) for commercial development” Sawcutting Pollution Prevention Street Sweeping and Cleaning (add all other BMPs for the site in this list) Reseeding Amount Unit Price of Seeding per acre: Vehicle Tracking Control Pad Example Erosion and Sediment Control Escrow/Security Calculation for Arrowhead Cottages BMP Amount Silt Fence Rock Sock Curb Inlet Protection Drop Inlet Protection Concrete Washout Area Detention Pond Outfall Protection APPENDIX G CONTRACTOR INSERTS )'7 SV7YTIVMRXIRHIRXWLEPPMHIRXMJ]MJ EHHMXMSREP&14WEVIRIIHIHGERFIVIQSZIHSVRIIHQEMRXIRERGI8LIGSRHMXMSRSJXLIGYVVIRXP]YWIH&14WWLEPPFI VIGSVHIHYWMRKSRISVQSVISJXLIJSPPS[MRKPIXXIVW - -RGSVVIGX-RWXEPPEXMSR 1 1EMRXIRERGIMWRIIHIH * &14JEMPIHXS STIVEXI % %HHMXMSREP&14MWRIIHIH 6 6IQSZI&143RP]&14W[MXLXLIGSRHMXMSRWEFSZIRIIHFIVIGSVHIH 8LI4VSNIGX)RKMRIIV[MPPETTVSZIERHXLI7YTIVMRXIRHIRXWLEPPHMVIGXXLI[SVOEWWSGMEXIH[MXLER]&14WMHIRXMJMIHMRXLMWHEMP] PSKXSIRWYVIGSQTPMERGI[MXLXLIWMXIWTIGMJMG7;14ERHXLI'(477'4 '(477'47XEXIWw&14WXLEXEVIRSXSTIVEXMRKIJJIGXMZIP]LEZITVSZIRXSFIMREHIUYEXISVLEZIJEMPIHQYWXFI EHHVIWWIHEWWSSREWTSWWMFPIMQQIHMEXIP]MRQSWXGEWIWx 0SGEXMSR &148]TI 'SRHMXMSR 2SXIW'SQQIRXW (EXI 'SQTPIXIH -RMXMEPW 4%SVQ+)3* '(38* IKTVSNIGXWXEXMSRRYQFIVQMPIQEVOIVMRXIVWIGXMSRUYEHVERXIXG  -RHMGEXIXLIX]TISJ&14EXXLMWPSGEXMSRXLEXVIUYMVIWEXXIRXMSR IKWMPXJIRGIIVSWMSRPSKWWSMPVIXIRXMSRFPEROIXW IXG  -HIRXMJ]XLIGSRHMXMSRSJXLI&14YWMRKSRISVQSVISJXLIJSPPS[MRKPIXXIVW - -RGSVVIGX-RWXEPPEXMSR 1 1EMRXIRERGI MWRIIHIH MIWIHMQIRXRIIHWXSFIVIQSZIH  * &14*EMPIHXSSTIVEXI % %HHMXMSREP&14MWRIIHIH 6 6IQSZIXLI&14 -JEPP&14WEVIMRSTIVEXMRKGSRHMXMSRERHRS&14QEMRXIRERGIMWRIIHIHWMKRERHMRMXMEPXLIFS\XSXLIVMKLXSJXLI WXEXIQIRX 4VSZMHIXLITVSTSWIHGSVVIGXMZIEGXMSRRIIHIHXSFVMRKXLIEVIESV&14MRXSGSQTPMERGI (EXIERHMRMXMEP[LIRXLIGSVVIGXMZIEGXMSR[EWGSQTPIXIH 7MKRXLIJSVQ[LIRXLIMRWTIGXMSRLEWFIIRGSQTPIXIH 4PEGIXLIGSQTPIXIHHEMP]WXSVQ[EXIVPSKWLIIX W MRXLI7;142SXIFSSO 4%+)3* '(38*SVQ G HEMP]WXSVQ[EXIVGSQTPMERGIMRWTIGXMSRWEVIVIUYMVIHSREPPTVSNIGXWLSPHMRKE'SPSVEHS (MWGLEVKI4IVQMX7]WXIQz7XSVQ[EXIV'SRWXVYGXMSR4IVQMX '(477'4  8LMWJSVQMWXSFIYWIHEWXLIHEMP]HMEV]XSIZEPYEXI&14WYWIHHYVMRKGSRWXVYGXMSREGXMZMXMIW 7IIXLIMRWXVYGXMSRWJSVQSVIMRJSVQEXMSR (EXI 4VSNIGXRYQFIV 7YFEGGSYRXRYQFIV 8LIIRXMVIWMXIWLEPPFIMRWTIGXIHXSHIXIVQMRI[LIXLIV&14WEVIFIMRKMQTPIQIRXIHERHQEMRXEMRIHMREGGSVHERGI[MXLXLI TVSNIGXvWWMXIWTIGMJMG7;14ERHXLI'(477'48LI)VSWMSR'SRXVSP7YTIVZMWSV )'7 SV7YTIVMRXIRHIRXWLEPPMHIRXMJ]MJ EHHMXMSREP&14WEVIRIIHIHGERFIVIQSZIHSVRIIHQEMRXIRERGI8LIGSRHMXMSRSJXLIGYVVIRXP]YWIH&14WWLEPPFI VIGSVHIHYWMRKSRISVQSVISJXLIJSPPS[MRKPIXXIVW - -RGSVVIGX-RWXEPPEXMSR 1 1EMRXIRERGIMWRIIHIH * &14JEMPIHXS STIVEXI % %HHMXMSREP&14MWRIIHIH 6 6IQSZI&143RP]&14W[MXLXLIGSRHMXMSRWEFSZIRIIHFIVIGSVHIH 9WIXLI I\XVETEKIEXXLIIRHSJXLMWJSVQMJRIIHIH  8LI4VSNIGX)RKMRIIV[MPPETTVSZIERHXLI7YTIVMRXIRHIRXWLEPPHMVIGXXLI[SVOEWWSGMEXIH[MXLER]&14WMHIRXMJMIHMRXLMWHEMP] PSKXSIRWYVIGSQTPMERGI[MXLXLIWMXIWTIGMJMG7;14ERHXLI'(477'4 '(477'47XEXIWw&14WXLEXEVIRSXSTIVEXMRKIJJIGXMZIP]LEZITVSZIRXSFIMREHIUYEXISVLEZIJEMPIHQYWXFI EHHVIWWIHEWWSSREWTSWWMFPIMQQIHMEXIP]MRQSWXGEWIWx 0SGEXMSR &148]TI 'SRHMXMSR 2SXIW'SQQIRXW (EXI 'SQTPIXIH -RMXMEPW %00&147%6)-234)6%8-2+'32(-8-32%2(231%-28)2%2')-72))()(  MRMXMEPXLIFS\XSXLIVMKLX[LIRXLMWETTPMIW 'SQQIRXW+IRIVEPRSXIW EXXEGLTLSXSWMJRIGIWWEV] -RWTIGXMSRWMKREXYVI 7YTIVMRXIRHIRXSV)'72EQI 4VMRX 7MKREXYVIEXIWMKRIH ( 4%SVQ+)3* '(38* T T VAULT ELEC GAS V.P. ST ST ST ST ST ST ST ST ST ST ST ST ST SS SS SS SS SS SS SS SS SS SS SS SS SS SS SS SS SS SS ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST ST SS SS SS SS SS SS SS SS SS SS SS SS T T T T T T T T T T T T T T T T T T ST ST E E E E E E E E E E E E E E W W W W W W W W W W W W W W W W W W W W W W W W W W W W CONTROL IRR F E S S h2o H2O C S W WV H Y D WV S S C.O. C.O. C.O. C.O. WV H2OW ST ST ST ST ST ST ST ST ST ST ST W W D D D D ST ST ST MDJ MDJ GATHERING AREA SANDSTONE BENCHES NATURAL HABITAT BUFFER ZONE PER APPROVED MINOR AMMENDMENTS PHASE 1 PLANS RAIN GARDEN CENTRE AVENUE WORTHINGTON CIRCLE 3 UNIT RANCH BUILDING 6 UNIT 2 STORY BUILDING 4 DETACHED GARAGES EXISTING BUILDING TRACT A SANDSTONE BENCHES SANDSTONE BENCHES BSP CBS CBS ELECTRIC METER LOCATION ELECTRIC METER LOCATION FORT COLLINS, CO ARROWHEAD COTTAGES GROUP landscape architecture|planning|illustration 444 Mountain Ave. Behtroud,CO 80513 TEL WEB 970.532.5891 TBGroup.us PROJECT TITLE REVISIONS ISSUE DATE SHEET TITLE SHEET INFORMATION DATE SEAL January 27, 2016 DATE PREPARED FOR LANDMARK REAL ESTATE HOLDINGS LLC 1170 W Ash St # 100 Windsor, CO 80550-4783 (970) 460-0567 CONTACT: Jason Sherrill MAJOR AMENDMENT COMMENTS 2/17/16 COMMENTS 4/12/16 COMMENTS 5/6/16 Plant List Landscape Legend SCALE 1" = 20'-0" 0 20' 30' 40' NORTH Landscape Plan Landscape Plan LS 2 A FREE PERMIT MUST BE OBTAINED FROM THE CITY FORESTER BEFORE ANY STREET TREES ARE PLANTED IN PARKWAYS BETWEEN THE SIDEWALK AND CURB AND IN STREET MEDIANS. STREET TREE LOCATIONS AND NUMBERS MAY CHANGE TO MEET ACTUAL UTILITY/TREE SEPARATION STANDARDS. LANDSCAPE CONTRACTOR MUST OBTAIN APPROVAL OF STREET TREE LOCATIONS AFTER UTILITY LOCATES. STREET TREES MUST BE INSPECTED AND APPROVED BEFORE PLANTING. FAILURE TO OBTAIN THIS PERMIT IS A VIOLATION OF THE CODE OF THE CITY OF FORT COLLINS. Gleditsia triacanthos inermis Size: 9" Mitigation: 1 Gleditsia triacanthos inermis Size: 11" Mitigation: 1 Gleditsia triacanthos inermis Size: 12" Mitigation: 1 Gleditsia triacanthos inermis Size: 9" Mitigation: 2 Gleditsia triacanthos inermis Size: 10" Mitigation: 2 Gleditsia triacanthos inermis Size: 11" Mitigation: 2 Gleditsia triacanthos inermis Size: 16" Mitigation: 2 NOTE: PLEASE SEE SECTION 3.4.1 OF THE LAND USE CODE FOR ALLOWBALE USES WITHIN THE BUFFER ZONE. THE NHBZ IS MEANT TO BE MAINTAINED IN A NATIVE LANDSCAPE Note: Proposed upsized mitigation trees/size marked with *. Existing mitigation trees listed on plan. 13 Trees to be upsized per the mitigation requirements from Arrowhead Phase 1 Minor Ammendment 6"-8" WASHED RIVER COBBLE OVER FABRIC BARRIER (MOD. HYDROZONE) IRRIGATED DURA TURF TYPE TALL FESCUE SOD (MOD. HYDROZONE) 5" DEPTH SHREDDED CEDAR MULCH OVER FABRIC BARRIER (MOD. HYDROZONE) RAIN GARDEN GRASS SEED MIX NATIVE GRASS (VERY LOW HYDROZONE) ROLLED TOP METAL EDGING SANDSTONE BENCHES NATURAL HABITAT BUFFER ZONE TALL FESCUE SEED MIX BOUNDARY OF PROPOSED LANDSCAPE STREET LIGHT EXISTING PROPOSED STREET LIGHT LOCATION PER PHOTOMETRIC PLANS TRANSFORMER TRANSFORMER DAY. VEHICLE TRACKING CONTROL PAD SHALL BE REMOVED AT THE END OF CONSTRUCTION. THE AREA SHOULD BE TOPSOILED, SEEDED, CRIMPED, AND MULCHED OR OTHERWISE STABILIZED. MAINTENANCE NOTES: 1. 2. 3. 3" - 6" ROCK CONSTRUCTION FENCE, TYP., TO DISCOURAGE VEHICLE ACCESS EXCEPT AT VTC SIGN "CONSTRUCTION ENTRANCE" R=5' PAVED SURFACE 20' MIN. 3" - 6" ROCK NO MATERIALS INCLUDING 2x4'S, PIPES, DIRT, GRAVEL OR ASPHALT, SHALL BE PLACED IN GUTTER TO FACILITATE MOUNTING CURB; HOWEVER, CURB MAY BE CUT DOWN TO A HEIGHT OF 2" OR HIGHER FOR EASIER ACCESS AND REPLACED AT PROJECT COMPLETION. OTHER ACCESS DEVICES MAY BE USED AS ACCEPTED BY THE CITY. CURB CUT 50' MIN. 2" MIN. 6" MIN. 6" MIN. ALTHOUGH NOT NORMALLY USED, THE CITY RESERVES THE RIGHT TO REQUIRE VEHICLE TRACKING CONTROL WITH A TEMPORARY CATTLE GUARD AND/OR WHEEL WASH FACILITIES AT SITES WHERE TRACKING ONTO PAVED AREAS BECOMES A SIGNIFICANT PROBLEM AS DETERMINED BY THE CITY INSPECTOR. IF VEHICLE TRACKING CONTROL WITH WHEEL WASH FACILITIES ARE REQUIRED, ALL WHEELS ON EVERY VEHICLE LEAVING THE SITE SHALL BE CLEANED OF MUD USING A PRESSURE-WASHER. THE CONTRACTOR SHALL BE RESPONSIBLE FOR OBTAINING A WATER SOURCE AND CONSTRUCTING A WASHWATER SEDIMENT TRAP. 5. 6. IF VEHICLE WHEEL WASH FACILITIES ARE REQUIRED, CONTRACTOR SHALL INSPECT VEHICLE TRACKING CONTROL AND WHEEL WASH FACILITIES DAILY. ACCUMULATED SEDIMENTS SHALL BE REMOVED FROM THE PAD SURFACE. ACCUMULATED SEDIMENT IN THE WASHWATER/SEDIMENT TRAP SHALL BE REMOVED WHEN THE SEDIMENT REACHES AN AVERAGE DEPTH OF 12-INCHES. 4. 5. COMPACTED BACKFILL FLOW SILT FENCE FABRIC (ASTM D6461) ANCHORED IN TRENCH AND ATTACHED TO POST. 24" MIN 6' MAX FLOW TRENCH AND ATTACHED TO POST. 4"x4" TRENCH SILT FENCE FABRIC (ASTM D6461) ANCHORED IN 18" MIN 24" MIN 42" MIN POSTS JOIN FIRST ROTATE SECOND POSTS SHALL OVERLAP AT JOINTS SO THAT NO GAPS EXIST IN SILT FENCE. NOTE: THICKNESS OF GEOTEXTILE POST SHALL BE JOINED AS SHOWN, THEN HAS BEEN EXAGGERATED. ROTATED 180° IN DIRECTION SHOWN AND DRIVEN INTO THE GROUND. DRIVE POSTS VERTICALLY INTO THE GROUND TO A MINIMUM DEPTH OF 18". EXCAVATE A TRENCH APPROXIMATELY 4" WIDE AND 4" DEEP ALONG THE LINE OF POSTS AND UPSLOPE FROM THE BARRIER. ANCHOR TRENCH SHALL BE EXCAVATED BY HAND, WITH TRENCHER, OR WITH SILT FENCE INSTALLATION MACHINE. NO ROAD GRADERS, BACKHOES, ETC. SHALL BE USED. NOT LESS THAN THE BOTTOM 1' OF THE SILT FENCE FABRIC SHALL BE BURIED IN THE TRENCH. THE TRENCH SHALL BE COMPACTED BY HAND, WITH "JUMPING JACK" OR BY WHEEL ROLLING. COMPACTION SHALL BE SUCH THAT THE SILT FENCE RESISTS BEING PULLED OUT OF ANCHOR TRENCH BY HAND. SILT FENCE INDICATED IN THE PLANS SHALL BE INSTALLED PRIOR TO ANY LAND-DISTURBING ACTIVITIES. USE WOOD POSTS OR OTHER MATERIAL AS ACCEPTED BY THE CITY. INSTALLATION NOTES: 1. 2. 3. 4. 5. 6. 7. THE CONTRACTOR SHALL INSPECT SILT FENCE EVERY TWO WEEKS AND AFTER SIGNIFICANT STORM EVENTS AND MAKE REPAIRS OR CLEAN OUT UPSTREAM SEDIMENT AS NECESSARY. SEDIMENT ACCUMULATED UPSTREAM OF SILT FENCE SHALL BE REMOVED WHEN THE UPSTREAM SEDIMENT REACHES A DEPTH OF 6". SILT FENCE SHALL BE REMOVED WHEN THE UPSTREAM DISTURBED AREA IS STABILIZED AND GRASS COVER IS ACCEPTED BY THE CITY. IF ANY DISTURBED AREA EXISTS AFTER REMOVAL, IT SHALL BE SEEDED AND MULCHED OR OTHERWISE STABILIZED IN A MANNER ACCEPTED BY THE CITY. MAINTENANCE NOTES: 1. 2. 3. 4" MIN. 4" MIN. 1 1 2" x 1 1 2" WOODEN FENCE POSTS COMPACTED BACKFILL 401 VEHICLE TRACKING CONTROL PAD 402 CONCRETE WASHOUT AREA VTC CWA 403 SILT FENCE SF SF INLET PROTECTION - AREA INLET IN SUMP Urban Drainage and Figure C5-21 Flood Control District Drainage Criteria Manual (V.3) AREA INLET - PLAN SECTION A ROCK FILTER JOINT DETAIL INLET PROTECTION CONTINUED 1-1/2" CRUSHED ROCK ENCLOSED IN WIRE MESH FILTERED RUNOFF AREA INLET 10' MIN. 2" IN SOIL 0" ON PAVEMENT 12" 12" ANY GAP AT JOINT SHALL BE FILLED WITH 1 1/2" CRUSHED ROCK AND WRAPPED WITH ADDITIONAL WIRE MESH SECURED TO ENDS OF ROCK REINFORCED BERM SEE JOINT DETAIL, THIS SHEET A AREA INLET (TYPE C SHOWN) REINFORCED ROCK BERM SEE SB DETAIL 5. REINFORCED ROCK BERM SHALL BE CONSTRUCTED IN ONE PIECE OR SHALL BE CONSTRUCTED USING JOINT DETAIL. ON ENDS OF BERM. 4. WIRE MESH SHALL BE SECURED USING "HOG RINGS" OR WIRE TIES AT 6-INCH CENTERS ALONG ALL JOINTS AND AT 2-INCH CENTERS "CHICKEN WIRE"). ROLL WIDTH SHALL BE 48-INCHES. 3. WIRE MESH SHALL BE FABRICATED OF 10 GAUGE WIRE TWISTED INTO A MESH WITH A MAXIMUM OPENING OF 1.0 INCH (COMMONLY TERMED MINUS). RECYCLED CONCRETE MEETING THIS GRADATION MAY BE USED. 2. CRUSHED ROCK SHALL BE FRACTURED FACE (ALL SIDES) AND SHALL COMPLY WITH GRADATION SHOWN IN CDOT SECT. 703-2, #4 aggregate (1-1/2" INLET PROTECTION AFTER INLET CONSTRUCTION OF AFTER PAVEMENT SHALL BE INSTALLED WITHIN 48 HOUR AFTER INLET CONSTRUCTION OR PAVING IS COMPLETED. 1. INLET PROTECTION INSTALLATION NOTES INLET PROTECTION MAINTENANCE NOTES OTHERWISE STABILIZED IN A MANNER APPROVED BY THE LOCAL JURISDICTION. 4. WHEN INLET PROTECTION AT AREA INLETS IS REMOVED, THE DISTURBED AREA SHALL BE COVERED WITH TOP SOIL, DRILL SEEDED AND CRIMP MULCHED, OR JURISDICTION APPROVES EARLIER REMOVAL OF INLET PROTECTION IN STREETS. 3. INLET PROTECTION IS TO REMAIN IN PLACE UNTIL THE UPSTREAM DISTURBED AREA IS STABILIZED AND GRASS COVER IS APPROVED, UNLESS THE LOCAL INCHES OF THE CREST. 2. SEDIMENT ACCUMULATED UPSTREAM OF INLET PROTECTION SHALL BE REMOVED WHEN THE SEDIMENT DEPTH UPSTREAM OF ROCK BERM IS WITHIN 2-1/2 INSPECT FREQUENTLY DURING WINTER CONDITIONS DUE TO FREEZE/THAW PROBLEMS. REPAIRS AS NEEDED. NECESSARY. MORE 1. THE SWMP MANAGER SHALL INSPECT INLET PROTECTION WEEKLY, DURING AND AFTER ANY STORM EVENT AND MAKE REPAIRS OR CLEAN OUT AS DETAIL BASED ON DETAILS PROVIDED BY DOUGLAS COUNTY 404 CURB INLET PROTECTION 405 AREA INLET PROTECTION CIP IP 406 DETENTION POND OUTFALL PROTECTION OP F E S ST ST ST ST ST ST ST D D D D D CENTRE AVENUE WORTHINGTON CIRCLE EXISTING STUCCO BUILDING EXISTING APARTMENT BUILDING NEW MERCER DITCH BLDG 1 BLDG 2 GARAGE RP IP CIP IP IP IP IP IP IP IP IP CIP VTC IP CIP SF SF SF SF SF SF SF SF SF SF SF SF SF SF SF SF SF SF SF SF SF SF CWA RS RP RS OP CIP Sheet Of 16 Sheets ARROWHEAD COTTAGES These drawings are instruments of service provided by Northern Engineering Services, Inc. and are not to be used for any type of construction unless signed and sealed by a Professional Engineer in the employ of Northern Engineering Services, Inc. NOT FOR CONSTRUCTION REVIEW SET 200 South College Avenue, Suite 010 Fort Collins, Colorado 80524 ENGINEER ING N O R T H E RN PHONE: 970.221.4158 FAX: 970.221.4159 www.northernengineering.com EC2 EROSION CONTROL PLAN DYNAMIC CALL UTILITY NOTIFICATION CENTER OF COLORADO Know what's below. Call before you dig. R NORTH ( IN FEET ) 1 inch = ft. 30 0 30 Feet 30 60 90 NOTE: ALL BMP'S SHOWN ON THIS PLAN ARE GRAPHIC REPRESENTATIONS ONLY. FINAL DETERMINATION OF SIZE AND LOCATION SHALL BE DETERMINED BY THE CONTRACTOR AND DOCUMENTED ON THE DYNAMIC SITE PLAN. 1. CONTRACTOR SHALL IMMEDIATELY STABILIZE ALL DISTURBED SLOPES BY CRIMP MULCHING OR SIMILAR METHODS (AS APPLICABLE). 2. TOTAL DISTURBED AREA = 1.06 ACRES 3. SWMP ADMINISTRATOR: Contact ________________________________ Company ________________________________ Address ________________________________ Phone________________________________ 4. CONTRACTOR TO PROVIDE VEHICLE TRACKING CONTROL FOR CONCRETE WASHOUT AREA IF ACCESS IS OFF PAVEMENT. 5. REFER TO THE "STORM WATER MANAGEMENT PLAN & EROSION CONTROL REPORT FOR ARROWHEAD COTTAGES" BY NORTHERN ENGINEERING, DATED 06/01/16 FOR ADDITIONAL INFORMATION. GENERAL NOTES: LEGEND: PROPOSED CONTOUR EXISTING STORM SEWER PROPOSED STORM SEWER PROPOSED SWALE EXISTING CONTOUR PROPOSED CURB & GUTTER PROPOSED STORM INLET PROPOSED CONCRETE CROSS PAN (TYP.) PEDESTRIAN ACCESS RAMPS VEHICLE TRACKING CONTROL PAD SILT FENCE SWALE WATTLE DIKE INLET PROTECTION ROCK SOCK CONCRETE WASHOUT AREA TEMPORARY BMP'S SF LIMITS OF DISTURBANCE WD VTC SF IP RS CWA CURB INLET PROTECTION CIP RIPRAP PROTECTION RP OUTFALL PROTECTION OP TABLE OF CONSTRUCTION SEQUENCE AND BMP APPLICATION/REMOVAL Project: Arrowhead Cottages Date: JUNE 1, 2016 Contractor to utilize this table to indicate when construction activities occur and when each associated BMP is installed or removed. CONSTRUCTION PHASE (Monthly) 1 2 3 4 5 6 7 8 9 10 11 12 Comments Grading Overlot Swales, Drainageways Pipeline Installation Water Main Asphalt and Concrete Installation Building Structure Miscellaneous Hardscape Amenities BEST MANAGEMENT PRACTICES Temporary Contour Furrows and Diversion Dikes (Ripping/Disking) Inlet Protection (IP) Vehicle Tracking Control (VTC) Flow Barriers (Bales, Wattles, Etc) (WD) Concrete Washout Area (CWA) Preventative Maintenance Activities/Meetings/ etc. Permanent Mulching/Sealant Permanent Seed Planting Curb and Gutter Parking and Drive Aisles Grass Swale Scour Stop Riprap Water Quality Pond F E S ST ST ST ST ST ST ST D D D D D CENTRE AVENUE WORTHINGTON CIRCLE EXISTING STUCCO BUILDING EXISTING APARTMENT BUILDING NEW MERCER DITCH BLDG 1 BLDG 2 GARAGE RP IP CIP IP IP IP IP IP IP IP IP CIP VTC IP CIP SF SF SF SF SF SF SF SF SF SF SF SF SF SF SF SF SF SF SF SF SF SF CWA RS RP RS OP CIP Sheet Of 16 Sheets ARROWHEAD COTTAGES These drawings are instruments of service provided by Northern Engineering Services, Inc. and are not to be used for any type of construction unless signed and sealed by a Professional Engineer in the employ of Northern Engineering Services, Inc. NOT FOR CONSTRUCTION REVIEW SET 200 South College Avenue, Suite 010 Fort Collins, Colorado 80524 ENGINEER ING N O R T H E RN PHONE: 970.221.4158 FAX: 970.221.4159 www.northernengineering.com EC1 EROSION CONTROL PLAN STATIC CALL UTILITY NOTIFICATION CENTER OF COLORADO Know what's below. Call before you dig. R NORTH ( IN FEET ) 1 inch = ft. 30 0 30 Feet 30 60 90 NOTE: ALL BMP'S SHOWN ON THIS PLAN ARE GRAPHIC REPRESENTATIONS ONLY. FINAL DETERMINATION OF SIZE AND LOCATION SHALL BE DETERMINED BY THE CONTRACTOR AND DOCUMENTED ON THE DYNAMIC SITE PLAN. 1. CONTRACTOR SHALL IMMEDIATELY STABILIZE ALL DISTURBED SLOPES BY CRIMP MULCHING OR SIMILAR METHODS (AS APPLICABLE). 2. TOTAL DISTURBED AREA = 1.06 ACRES 3. SWMP ADMINISTRATOR: Contact ________________________________ Company ________________________________ Address ________________________________ Phone________________________________ 4. CONTRACTOR TO PROVIDE VEHICLE TRACKING CONTROL FOR CONCRETE WASHOUT AREA IF ACCESS IS OFF PAVEMENT. 5. REFER TO THE "STORM WATER MANAGEMENT PLAN & EROSION CONTROL REPORT FOR ARROWHEAD COTTAGES" BY NORTHERN ENGINEERING, DATED 06/01/16 FOR ADDITIONAL INFORMATION. GENERAL NOTES: LEGEND: PROPOSED CONTOUR EXISTING STORM SEWER PROPOSED STORM SEWER PROPOSED SWALE EXISTING CONTOUR PROPOSED CURB & GUTTER PROPOSED STORM INLET PROPOSED CONCRETE CROSS PAN (TYP.) PEDESTRIAN ACCESS RAMPS VEHICLE TRACKING CONTROL PAD SILT FENCE SWALE WATTLE DIKE INLET PROTECTION ROCK SOCK CONCRETE WASHOUT AREA TEMPORARY BMP'S SF LIMITS OF DISTURBANCE WD VTC SF IP RS CWA CURB INLET PROTECTION CIP 1. IT SHOULD BE NOTED THAT ANY EROSION CONTROL PLAN SERVES ONLY AS A GUIDELINE TO THE CONTRACTOR. STAGING AND/OR PHASING OF BEST MANAGEMENT PRACTICES (BMPs) IS EXPECTED. ADDITIONAL AND/OR DIFFERENT BMPs FROM THOSE ORIGINALLY DEPICTED MAY BE NECESSARY DURING CONSTRUCTION DUE TO CHANGING SITE CONDITIONS OR AS REQUIRED BY LOCAL AUTHORITIES. 2. THIS EROSION CONTROL PLAN IS SCHEMATIC IN NATURE. AS SUCH, GRAPHICAL SYMBOLS MAY NOT BE TO SCALE, NOR ARE THEY NECESSARILY SHOWN IN THEIR EXACT LOCATION. 3. THE CONTRACTOR SHALL BE RESPONSIBLE FOR ALL PERMITTING (CITY, STATE DISCHARGE PERMIT, ETC.) AND COMPLIANCE WITH GOVERNING AUTHORITIES. IT SHALL BE THE RESPONSIBILITY OF THE CONTRACTOR (OR PERMIT HOLDER) TO ENSURE EROSION CONTROL MEASURES ARE PROPERLY MAINTAINED AND FOLLOWED. 4. CONTRACTOR SHALL IMPLEMENT THE APPROPRIATE EROSION CONTROL MEASURES ACCORDING THE THE CONSTRUCTION SEQUENCING AND LEVEL OF SITE STABILIZATION. 5. CONTRACTOR SHALL IMPLEMENT APPROPRIATE INLET PROTECTION FOR ALL STORM DRAINS, SWALES, PONDS AND RAIN GARDENS UNTIL SITE IS FULLY STABILIZED. 6. CONTRACTOR SHALL IMPLEMENT APPROPRIATE INLET PROTECTION FOR DOWNSPOUT CONNECTIONS, TO THE STORM DRAIN SYSTEM, UNTIL CONNECTION IS ESTABLISHED WITH DOWNSPOUT. 7. INLET PROTECTION SHALL BE ADAPTED, AS NECESSARY, TO THE SURROUNDING SURFACE TYPE AND CONDITION (i.e., STAKE-DRIVEN WATTLES FOR BARE SOIL, SAND BAGS OR GRAVEL SOCKS FOR PAVEMENT, ETC.) 8. CONTRACTOR IS RESPONSIBLE FOR STABILIZING ALL SLOPES, PARTICULARLY THOSE STEEPER THAN 6:1. CRIMP MULCHING, HYDRO MULCHING, EROSION MATS, TEMPORARY IRRIGATION, AND ADDITIONAL WATTLES OR SILT FENCING MAY BE NECESSARY TO ESTABLISH VEGETATIVE COVER AND STABILIZE THE SLOPE. 9. ADDITIONAL WATTLES, SILT FENCE, OR OTHER MEASURES, MAY BE NECESSARY TO INSURE THAT EACH BUILDING PAD IS STABILIZED THROUGHOUT CONSTRUCTION. AT NO TIME SHALL SEDIMENT BE ALLOWED TO CROSS THE PUBLIC SIDEWALKS. 10. CONTRACTOR SHALL IMPLEMENT APPROPRIATE PERIMETER PROTECTION FOR AREAS DIRECTING DRAINAGE OFFSITE. PERIMETER PROTECTION SHALL BE ADAPTED, AS NECESSARY, TO THE SURROUNDING SURFACE TYPE AND CONDITION (i.e., STAKE-DRIVEN SEDIMENT CONTROL LOGS OR SILT FENCE FOR BARE SOIL, SAND BAGS OR GRAVEL SOCKS FOR PAVEMENT, ETC.) 11. FUELING FACILITIES SHALL BE LOCATED AT LEAST ONE HUNDRED (100) FEET FROM NATURAL BODY OF WATER, WETLAND, NATURAL DRAINAGE WAY OR MANMADE DRAINAGE WAY. THE FUEL TANKS AND FUELING AREA MUST BE SET IN A CONTAINMENT AREA THAT WILL NOT ALLOW A FUEL SPILL TO DIRECTLY FLOW, SEEP, RUN OFF, OR BE WASHED INTO A BODY OF WATER, WETLAND OR DRAINAGE WAY. 12. CONSTRUCTION WASTE STORAGE (DUMPSTERS) AND PORTABLE SANITATION UNITS (CONSTRUCTION TOILETS) SHALL BE LOCATED AT LEAST FIFTY (50) FEET FROM ANY STORMWATER INLET, WETLAND, OR DRAINAGE WAY. SAID FACILITIES MUST BE SET IN A CONTAINMENT AREA THAT WILL NOT ALLOW POLLUTANTS TO DIRECTLY FLOW, SEEP, RUN OFF, OR BE WASHED INTO A BODY OF WATER, WETLAND OR DRAINAGE WAY. DUMPSTERS SHALL BE LOCATED ON FLAT, STABLE GROUND, AND CONSTRUCTION TOILETS SHALL BE STAKED DOWN. 13. THE CONTRACTOR AND ALL SUBCONTRACTORS WILL COOPERATE WITH THE CITY'S CONSTRUCTION INSPECTORS BY CEASING OPERATIONS WHEN WINDS ARE OF SUFFICIENT VELOCITY TO CREATE BLOWING DUST WHICH, IN THE INSPECTOR'S OPINION, IS HAZARDOUS TO THE PUBLIC HEALTH AND WELFARE. 14. WHERE SEASONAL CONSTRAINTS (E.G., DURING SUMMER AND WINTER MONTHS) INHIBIT PERMANENT SEEDING OPERATIONS, DISTURBED AREAS WILL BE TREATED WITH MULCH AND MULCH TACKIFIER OR OTHER MATERIALS APPROVED BY EROSION CONTROL STAFF TO PREVENT EROSION. 15. SEE LANDSCAPE PLANS FOR ADDITIONAL INFORMATION ON PLANTING, REVEGETATION, HARDSCAPE AND OTHER PERMANENT SITE STABILIZATION METHODS. 16. ALL ROOF DRAIN SYSTEM INLETS SHAL BE PLUGGED UNTIL CONNECTED TO BUILDINGS. EROSION CONTROL NOTES: TABLE OF CONSTRUCTION SEQUENCE AND BMP APPLICATION Project: ARROWHEAD COTTAGES CONSTRUCTION PHASE MOBILIZATION DEMOLITION GRADING BEST MANAGEMENT PRACTICES (BMPS) STRUCTURAL "INSTALLATION" Silt Fence Barriers * Flow Barriers (Wattles) * Inlet Filter Bags * Vegetative Temporary Seeding Planting Mulching / Sealant Permanent Seeding Planting Sod Installation Rolled Products : Netting / Blankets / Mats Contour Furrows (Ripping / Disking) Rock Bags * UTILITIES INSTALLATION FLAT WORK INSTALLATION VERTICAL INSTALLATION LANDSCAPE DEMOBILIZATION Vehicle Tracking Pad * * All Temporary BMPs to be Removed once Construction is Complete Any prior inlets that could use protecting Any prior inlets that could use protecting Anytime the site will sit dormant longer than 30 Days Anytime the site will sit dormant longer than 30 Days Anytime the site will sit dormant longer than 30 Days RIPRAP PROTECTION RP OUTFALL PROTECTION OP