Loading...
HomeMy WebLinkAboutCOUNCIL - AGENDA ITEM - 09/03/2019 - RESOLUTION 2019-092 APPROVING THE NORTHFIELD METROAgenda Item 13 Item #13 Page 1 AGENDA ITEM SUMMARY September 3, 2019 City Council STAFF Rachel Rogers, Senior Specialist Economic Sustainability Josh Birks, Economic Health Director John Duval, Legal SUBJECT Resolution 2019-092 Approving the Northfield Metro District Nos. 1 through 3 Consolidated Service Plan. EXECUTIVE SUMMARY The purpose of this item is for City Council to consider approval of the Northfield Metropolitan District Nos. 1 through 3 Consolidated Service Plan (the “Service Plan”). The developer of the proposed Northfield Development has submitted the Service Plan to support the proposed development of approximately 56 acres located north of Vine Street on the west side of Lindenmeier Road/Lemay Avenue (southeast of the Lake Canal and north of the to-be designated historic Alta Vista neighborhood). The development is anticipated to include 442 residential units and a mixed-use center that will offer light commercial use on the first floor, residential for-rent units on the second floor, and small amenities open to the public. The project has committed to provide approximately 15 percent for-sale affordable housing units. A Mill Levy Cap of 50.00 mills has been proposed under the Service Plan to support the project. As per the Council’s Metro District Policy, proceedings for a public hearing for a Metro District Service Plan public hearing are as follows: 1. Announcement of item 2. Consideration of any procedural issues 3. Explanation of the application by City staff 4. Presentation by the applicant (suggested time: 15 minutes) 5. Public testimony regarding the application 6. Rebuttal testimony by the applicant (suggested time: 10 minutes) 7. Councilmember questions of City staff and the applicant 8. Motion, discussion and vote by City Council. The public hearing for this Service Plan was previously noticed in accordance with Council’s Metro District Policy to be conducted at Council’s August 20, 2019, meeting. However, Council voted at that meeting, as authorized in Section 2.c. of the Council’s Rules of Procedure, to continue this matter to the Council’s next regular meeting, which is this September 3, 2019, meeting. The applicant mailed on August 22, 2019, notice of this continuance to the fee-title owners of property within the proposed Districts and published this notice in the Coloradoan on August 24, 2019. STAFF RECOMMENDATION Staff recommends adoption of the Resolution. Agenda Item 13 Item #13 Page 2 BACKGROUND / DISCUSSION Council’s Discretion under its Policy The Council’s Metro District Policy contemplates that Council will consider favorably those metro district service plans that will “deliver extraordinary public benefits.” However, the Policy also provides that approval of service plans is within the Council’s sole discretion. In the exercise of that discretion, the Council may reject, approve, or conditionally approve service plans on a case-by-case basis. The Council therefore retains under the Policy the full authority to determine whether the proposed “extraordinary public benefits” proposed under a particular service plan are sufficient. Project Overview Landmark Homes is proposing a residential community situated within walking distance of the City’s Old Town. The Planned Development incorporates goals of the following plans: City Plan, Transportation Master Plan, Master Street Plan, Nature in the City Strategic Plan, Natural Areas Master Plan, Paved Recreational Trail Master Plan, Northside Neighborhoods Plan, Pedestrian Plan, and Bicycle Master Plan. The proposed Northfield Metro District Nos. 1 through 3 (the “Metro Districts”) will support 56 acres of planned development located north of Vine Street on the west side of Lindenmeier Road/Lemay Avenue (southeast of the Lake Canal and north of the to-be designated historic Alta Vista neighborhood). (Attachment 1) The project anticipates constructing: x Approximately 442 residential units (a mix of single-family and multi-family). x Minimum of 14.7% affordable (65 units). x The remaining housing units in the project are expected to be priced in an attainable range, considered by other cities to be between 80% and 120% of AMI. Table 1 Proposed Unit Pricing Residential Units (2019-2025) Housing Type # Units Price Brownstones 139 $388,518 Flats 180 359,040 Value Condo 16 316,200 Stacked Condo 40 306,714 Deed Restricted Condo 65 265,200 Studio Rental 2 200,000 Total/Average 442 $347,504 x A mixed-use center that will offer light commercial use on the first floor, residential for-rent units on the second floor, and small amenities open to the public. Table 2 Commercial Building Space Pricing Commercial (2022) Type Sq Ft Price Retail 2,679 $225 Total $602,775 x An enhanced setback from the Lake Canal Wetlands to further protect them from new development; and x On-site Regional Trail as well as the off- site pedestrian connection for the northeastern portion up to the intersection at Lemay Avenue and Conifer Street. Agenda Item 13 Item #13 Page 3 Council Finance Review Follow-Up On July 15, 2019, the Council Finance Committee reviewed the proposed Consolidated Service Plan for Metro Districts. The Committee requested additional information on a few items: x Affordable Housing - How does the City ensure the Metro District will provide affordable housing? Below are some of the manners in which housing could be delivered, however, the list is not exhaustive: o Traditional Delivery - Existing affordable housing providers could construct units within the district using their traditional funding approaches. These units would need to be rented or sold at a price point that complies with the City’s policy. The monthly cost to the user would be no different within the district than outside the district. Therefore, the housing provider would need to identify and obtain additional subsidy to cover the resulting lower sales price for a unit that will cost the same inside and outside of a District. o Land Trust - A developer could elect to transfer or sell affordable housing lots to a Land Trust operating in the City. The Land Trust, typically a non-profit, would then reduce the tax burden to the occupant by removing 25 to 30 percent of property value associated with land. In addition, a Land Trust would also have to price units following the same principles - meaning that the net cost to the occupant would be consistent inside and outside a district. o Land Bank - A developer could elect to sell a portion of their property to the City’s land bank program at a market or discounted rate. These units would need to be rented or sold at a price point that complies with the City’s policy. The monthly cost to the user would be no different within the district than outside the district. The Economic Health Office understands the concern with the reservation of lots for affordable housing. Staff is looking into options for ensuring the building of affordable housing units and whether reservations or some alternative method will better achieve this goal. x How will the solar in the Metro District be managed? o Utilities is working on the analysis and management of solar within the system. As part of the broader system, staff is coordinating a work plan and schedule for the development of a distributed energy resources roadmap with the Energy Board and community stakeholders. The work plan will maintain alignment with proposed updates to the Energy Policy, Climate Action Plan Framework and Platte River Integrated Resources Plan. o Utilities is planning to incorporate “smart” inverter capabilities into our solar interconnection guidelines (for all installations). These capabilities will initially enable Utilities to prescribe settings, which will limit potential negative impacts of too much solar in specific areas. In the future, the inverters may allow Utilities to dynamically control settings which will support the electric distribution system. Agenda Item 13 Item #13 Page 4 Service Plan Overview Under Landmark Homes’ proposed Service Plan, the Metro Districts would be used to construct critical public infrastructure and other site costs reducing the overall development costs. Staff has reviewed the Service Plan and determined that it includes all the information required by Section 32- 1-202(2) of the Colorado Revised Statutes. The required information is: (a) A description of the Districts’ proposed services; (b) A financial plan showing how the proposed services are to be financed, including the proposed operating revenue derived from property taxes for the first budget year of the Districts; (c) All proposed indebtedness for the Districts displayed together with a schedule indicating the year or years in which the debt is scheduled to be issued; (d) A preliminary engineering or architectural survey showing how the proposed services are to be provided; (e) A map of the proposed Districts’ boundaries and an estimate of the population and valuation for assessment of the proposed Districts; (f) A general description of the facilities to be constructed and the standards of such construction, including a statement of how the facility and service standards of the proposed Districts will be compatible with the City’s facility and service standards; (g) A general description of the estimated cost of acquiring land, engineering services, legal services, administrative services, initial proposed indebtedness and estimated proposed maximum interest rates and discounts, and other major expenses related to the organization and initial operation of the Districts; and (f) A description of any arrangement or proposed agreement with any political subdivision for the performance of any services between the proposed Districts and such other political subdivision, and, if the form contract to be used is available, it shall be attached to the Service Plan. The Service Plan calls for the creation of three Metro Districts working collaboratively to deliver the proposed Northfield development. The phased development is anticipated to occur over the next nine plus years and support an estimated population of 1,139. A few highlights about the proposed Service Plan, include: x Assessed Value - Estimated to be approximately $13.3 million in 2029 at full build-out x Aggregate Mill Levy - 50 mills, subject to Gallagher Adjustments x Debt Mill Levy - 40 mills, may not be levied until an approved development plan or intergovernmental agreement has been executed that delivers the pledged public benefits x Operating Mill Levy - Up to an additional 10 mills (aggregate mill levy 50 mills) to fund several on-going operations, such as but not limited to: (a) a non-potable irrigation system, and (b) road infrastructure. Once a District imposes a Debt Mill Levy, such District’s Operating Mill Levy cannot exceed ten (10) mills at any point. x Maximum Debt Authorization - Anticipated to be approximately $16 million to cover a portion of the estimated $30 million in project costs x Regional Mill Levy - The Regional Mill Levy of 5 mills shall not be counted against the Aggregate Mill Levy Maximum Agenda Item 13 Item #13 Page 5 Public Improvements The Service Plan anticipates using the Debt Mill Levy to support the issuance of bonds in the maximum amount of $16 million to fund all or a portion of the following $30 million in public improvements (details available in Exhibits D and G of the Service Plan): x Earthwork and Grading - Approximately $5.4 million in earthwork and site preparation costs associated with the proposed project. x Roadway Improvements - Approximately $6.4 million in total costs to construct asphalt infrastructure for streets and parking on the project, including Suniga arterial (costed at $2.5M). x Potable Water Improvements - Approximately $0.6 million in costs to construct potable water infrastructure supporting the project. x Sanitary Sewer Improvement - Approximately $1.3 million constructing the sanitary sewer infrastructure, including upsizing, both on-site ($0.7M) and off-site ($0.6M) for the project x Storm Sewer Improvements - Approximately $1.9 million in costs to construct the main storm sewer system and infrastructure for the project. x Open Space/Landscaping - Approximately $4.0 million in costs for Regional Trail construction, neighborhood park development, development of clubhouse/pool, and other landscaping x Miscellaneous / Amenity - Approximately $5.5 million in miscellaneous costs associated with the project, such as engineering, inspection, and administrative costs, plus a 20% contingency estimate of $5.1 million. The subtotal for basic costs associated with public improvements through the Metro Districts is approximately $19.6 million; non-basic costs are approximately $10.5 million which brings the project to an approximate total of $30.1 million. Public Benefits As required by the City Council’s current Metro District Policy (Metro District Policy), the Service Plan will deliver several extraordinary development outcomes that support several public benefits. A general list of benefits and, where available, their estimated value is described below (details in Exhibit G of the Service Plan): Agenda Item 13 Item #13 Page 6 Table 3 Northfield Metro District Public Benefits Evaluation x Affordable Housing - The financing and reimbursement options created by the Metropolitan Districts will enable the Northfield project to deliver a minimum of 65 units or 14.7% of the total project at affordable rates. These units will be delivered under the following guidelines: o A minimum of 65 units (14.7%) will be affordable at the 80% or below AMI level. The developer has not yet determined if these will be for-sale or for-rent units. o Enforceability: Prior to or concurrent with Development Agreement, Northfield will create legally enforceable guarantees within the City for affordable housing commitments. Potential options include, contract with City for Land Bank, deed restriction, and reservation of acreage. o Units will be deed restricted for at least 20 years. x Environmental Sustainability o Energy Conservation ~Solar - Northfield plans to include solar panels on the 12-unit condominium buildings and the community clubhouse that will provide up to 14 kilowatts of power per building. These solar panels Agenda Item 13 Item #13 Page 7 will provide the power needed for the common area spaces, including elevators. The renewable energy provided by the solar panels will also decrease the common-space maintenance burden for residents in the condominium buildings. ~EV Chargers - Northfield will also deliver a 240V outlet in every garage to provide a place for the electric vehicle fast-charging stations and further encourage residents to drive eco-friendly cars. ~HERS Rating Commitment - All the homes at the attainable price point will commit to HERS ratings ranging from 49 to 55 compared to the average Fort Collins HERS ratings of new home ranging from 58 to 62. Increased energy efficient building materials and methods were considered to increase the energy efficiency of the homes. According to the HERS index, these homes in Northfield will be 45-51% more energy efficient than a standard new home and 75-81% more efficient than the average resale home. Landmark will contract with a green energy consultant to ensure the buildings are constructed according to energy efficient standards and that official HERS scores are certified upon completion. o Environmental Conservation - The project provides an enhanced setback from the Lake Canal Wetlands to further protect them from new development. The connections over Lake Canal will be constructed with low impact box culverts and abide by and exceed Army Core of Engineers standards for historic protected wetlands. Landscaped areas will focus on low-water usage designs. Initial hydro- zone calculations indicate Northfield will use 7.63 gallons of water per square foot, well below the City’s limit of 15 gallons of water per square foot. x Off-Site Sewer Improvements - Northfield plans to replace and upsize the sewer line from Vine Drive, around Alta Vista, and along a portion of Lemay Avenue. It is not clear at this early stage whether the developer or the district will contract for construction of the upsizing, but they will seek reimbursement from the city for the upsized portion. x Regional Trail - Rather than simply designating an on-site easement for the future trail construction by the City, Northfield plans to finance and deliver the on-site Regional Trail as well as the off-site pedestrian connection for the northeastern portion up to the intersection at Lemay Avenue and Conifer Street. x Community Gateway - Northfield will promote the City’s objective of preserving and enhancing historic resources. The southeastern edge of Northfield borders the to-be-designated historic Alta Vista neighborhood. To blend the transition to new development and pay homage to the neighborhood’s history, Northfield will feature an Interpretive Historical Park and Gateway Features bordering Alta Vista. These additions were developed in collaboration with neighbors in the Alta Vista neighborhood and would provide an extraordinary benefit to the City as a whole. x Economic Health Outcomes - Northfield is located within walking and/or biking distance to some of the largest employment hubs in the City, including City of Fort Collins Municipal Offices, Colorado State University, Woodward, and New Belgium Brewing. Northfield's proximity to these hubs and affordable and its attainable price points set the project apart from other recent residential developments in Fort Collins. Through Northfield, the City will gain high-quality, attainable housing near the City’s economic and cultural core, helping reduce congestion in the City and provide workforce housing. Agenda Item 13 Policy Comparison The conceptual use of a Metro District at Northfield complies with the City’s existing policy. Northfield Proposal Mulberry Waterfield Montava Current Policy Mill Levy Caps 50 Mills 50 Mills 50 Mills 60 Mills 50 Mills Basic Infrastructure Partially Partially Partially Partially To enable public benefit Eminent Domain Will Comply Will Comply Will Comply Will Comply Prohibited Debt Limitation Will Comply Will Comply Will Comply Will Comply 100% of Capacity Dissolution Limit Ongoing for O&M Ongoing for O&M Will Comply Will Comply 40 years (end user refunding exception) Citizen Control Will Comply Will Comply Will Comply Will Comply As early as possible Multiple Districts Yes Yes Yes Yes Projected over an extended period Commercial/ Residential Ratio Residential and Commercial Residential and Commercial 100% Residential Mixed Use N/A Performance Assurances The proposed Service Plan prohibits the issuance of any debt or imposition of the debt mill levy or fees to pay debt unless and until the delivery of the Public Benefits are secured for each development phase of the project in a manner that is approved by City Council, as outlined in the February 2019 updated City Metro District Policy. This requirement can be satisfied by one or both of the following methods, as applicable: x Intergovernmental Agreement - For any of the Public Benefits to be provided by one or more of the Metro Districts, each such District must enter into an intergovernmental agreement with the City agreeing to provide those Public Benefits as a legally enforceable multiple-fiscal year obligation of the District under TABOR or by securing performance of that obligation with a surety bond, letter of credit or other security acceptable to the City and all such intergovernmental agreements must be approved by the City Council by resolution; x Approved Development Plan - For any of the Public Benefits to be provided by one or more Developers of the Planned Development, each such Developer must enter into a development agreement with the City under the Developer’s applicable Approved Development Plan, which agreement must legally obligate the Developer to provide those Public Benefits before the City is required to issue building permits and/or certificates of occupancy for structures to be built under the Approved Development Plan for that phase of the Planned Development or to secure such obligations Public Benefits and Triple Bottom Line The Metro District Policy supports the formation of a metro district regardless of development type when a District delivers extraordinary public benefits. The public benefits should be: (1) aligned with the goals and objectives of the City whether such extraordinary public benefits are provided by the metro district or by the entity developing the metro district because metro districts exist to provide public improvements; and (2) not be practically provided by the City or an existing public entity, within a reasonable time and on a comparable basis. The Service Plan for the Northfield Project delivers several proposed policy outcomes. (Attachment 3) Triple Bottom Line - Scan An interdisciplinary staff team prepared a Triple Bottom Line Scan of the proposed Service Plan. (Attachment 4) The net analysis is generally neutral to slightly positive. The highlights are provided below: Item #13 Page 8 Agenda Item Item #13 Page 9 x Economic - The proposed affordable housing is expected to have a positive impact on retaining and attracting talent to strengthen our local labor force for employers. The pricing of the remaining homes at 80-120% of AMI meets the community’s needs for housing at that income level. Northfield is located within walking and/or biking distance to some of the largest employment hubs. x Environmental - Some benefit is expected from the proposed solar, but overall the proposed environmental public benefits were interpreted as weak by staff under the current proposal. Additional clarity is needed to assess any improved benefit. However, the applicant completed additional HERs testing after the Triple Bottom Line Scan was completed, and the positive results of the testing are not included in the Triple Bottom Line Report. x Social - This area is expected to have the most positive impact due to the commitments to affordable housing. Financial Assessment Utilizing the District’s Financial Plan, the City reviewed the Financial Plan in partnership with Economic & Planning Systems. (Attachment 5) The review concluded the following: x The proposed mill levies are in line with the City’s policy. x The market values used in the public revenue estimates are reasonable. x EPS expressed concern about residential absorption of Northfield in the context of other new North College developments: Waterfield, Water’s Edge, and Montava. x EPS found it difficult to assess if there would be “extraordinary benefits” with the following: clubhouse and swimming pool, allowed density/more open space, and increased landscaped area. Basic Infrastructure and Public Benefit The Metro District Policy allows a metro district to fund “basic infrastructure”, that which is typically expected to be provided by a developer (both in type and magnitude), when the inclusion of “basic” infrastructure offsets higher costs associated with extraordinary development outcomes that cannot directly be provided by a metro district (Defined in Exhibit A of the Metro District Policy, e.g., rooftop solar, affordable housing, etc.). The Developer has identified an estimated $18.7 million in public benefits which are outlined in Table 3. After reviewing the Service Plan, estimated public benefits, and the Maximum Debt Authorization of $16 million, staff recommends approval of the Service Plan. Estimated Property Taxes Table 4 Annual Tax Levied on Residential Property with $300,000 Actual Value within the District (Assuming Maximum District Mill Levy) Taxing Entity Mill Levies (2018) Annual tax levied Northfield Metropolitan District No. 50.00 $1,080.00 Poudre R-1 General Fund 40.30 $870.48 Larimer County 22.40 $483.90 Poudre R-1 Bond Payment 12.33 $266.33 City of Fort Collins 9.80 $211.62 Poudre River Public Library District 3.00 $64.80 Health District of Northern Larimer County 2.17 $46.81 Northern Colorado Water Cons. District 1.00 $21.60 Larimer County Pest Control District 0.14 $3.07 TOTAL: 141.14 $3,048.61 Agenda Item 13 Item #13 Page 10 Applicant Supplied Materials The applicant requesting consideration of the Service Plan has submitted a PowerPoint presentation for Council’s review. (Attachment 8) CITY FINANCIAL IMPACTS The proposed Service Plan will not have an impact on the City’s financials. The applicant has paid the fees required under the City’s Metro District Policy, which fees are designed to offset the cost of staff and outside consultant and legal review. In addition, the proposed Service Plan includes a requirement that the following notice be included in all debt issued by the Districts: “By acceptance of this instrument, the owner of this Debt agrees and consents to all of the limitations with respect to the payment of the principal and interest on this Debt contained herein, in the resolution of the District authorizing the issuance of this Debt and in the Service Plan of the District. This Debt is not and cannot be a Debt of the City of Fort Collins.” ATTACHMENTS 1. Vicinity Map (PDF) 2. Northfield Service Plan Compare to Model (PDF) 3. Public Benefit Matrix (PDF) 4. Triple Bottom Line Summary (PDF) 5. EPS Northfield Metro District Review (PDF) 6. Applicant Presentation (PDF) 7. Combined Vicinity Map (PDF) 8. PowerPoint Presentation (PDF) PROPOSED NORTHFIELD METRO DISTRICT N W E S DRAWN BY DATE SCALE (H) HDS PROJ SHEET OF NORTHFIELD VICINITY MAP 04/30/2019 1" = 1000' KRB 18-1000-00 EXHIBIT C 1 1 0 SCALE: 1" = 1000' 500 1000 ATTACHMENT 1 City of Fort Collins Title 32 Metropolitan CONSOLIDATED SERVICE PLAN FOR NORTHFIELD METROPOLITAN DISTRICT NOS. 1-3 CITY OF FORT COLLINS, COLORADO Prepared by: WHITE BEAR ANKELE TANAKA &WALDRON 2154 E. Commons Ave., Suite 2000 ATTACHMENT 2 Centennial, CO 80122 Submitted On: August 7, 2019 Approved on: [__________________] i TABLE OF CONTENTS I. INTRODUCTION .............................................................................................................. 1 A. Purpose and Intent................................................................................................... 1 B. Need for the Districts.............................................................................................. 2 C. Objective of the City Regarding Districts’ Service Plan. ....................................... 2 D. City Approvals........................................................................................................ 2 II. DEFINITIONS.................................................................................................................... 2 III. BOUNDARIES AND LOCATION.................................................................................... 6 IV. DESCRIPTION OF PROJECT, PLANNED DEVELOPMENT, PUBLIC BENEFITS & ASSESSED VALUATION ................................................................................................ 6 A. Project and Planned Development. ......................................................................... 7 B. Public Benefits........................................................................................................ 7 C. Assessed Valuation. ................................................................................................ 8 V. INCLUSION OF LAND IN THE SERVICE AREA ......................................................... 9 VI. DISTRICT GOVERNANCE.............................................................................................. 9 VII. AUTHORIZED AND PROHIBITED POWERS............................................................... 9 A. General Grant of Powers......................................................................................... 9 B. Prohibited Improvements and Services and other Restrictions and Limitations. ... 9 1. Eminent Domain Restriction..................................................................... 10 2. Fee Limitation........................................................................................... 10 3. Operations and Maintenance..................................................................... 10 4. Fire Protection Restriction........................................................................ 10 5. Public Safety Services Restriction............................................................ 11 6. Grants from Governmental Agencies Restriction..................................... 11 7. Golf Course Construction Restriction....................................................... 11 8. Television Relay and Translation Restriction........................................... 11 9. Potable Water and Wastewater Treatment Facilities................................ 11 10. Sales and Use Tax Exemption Limitation ................................................ 12 11. Sub-district Restriction ............................................................................. 12 12. Privately Placed Debt Limitation.............................................................. 12 13. Special Assessments ................................................................................. 12 VIII. PUBLIC IMPROVEMENTS AND ESTIMATED COSTS............................................. 12 A. Development Standards. ....................................................................................... 13 B. Contracting............................................................................................................ 14 ii C. Land Acquisition and Conveyance....................................................................... 14 D. Equal Employment and Discrimination................................................................ 14 IX. FINANCIAL PLAN/PROPOSED DEBT......................................................................... 14 A. Financial Plan........................................................................................................ 14 B. Mill Levies............................................................................................................ 15 1. Aggregate Mill Levy Maximum............................................................... 15 2. Regional Mill Levy Not Included in Other Mill Levies ........................... 15 3. Operating Mill Levy ................................................................................. 15 4. Gallagher Adjustments.............................................................................. 16 5. Excessive Mill Levy Pledges.................................................................... 16 6. Refunding Debt......................................................................................... 16 7. Maximum Debt Authorization.................................................................. 16 C. Maximum Voted Interest Rate and Underwriting Discount. ................................ 16 D. Interest Rate and Underwriting Discount Certification. ....................................... 17 E. Disclosure to Purchasers....................................................................................... 17 F. External Financial Advisor. .................................................................................. 17 G. Disclosure to Debt Purchasers. ............................................................................. 18 H. Security for Debt................................................................................................... 18 I. TABOR Compliance............................................................................................. 18 J. Districts’ Operating Costs..................................................................................... 18 X. REGIONAL IMPROVEMENTS...................................................................................... 19 A. Regional Mill Levy Authority. ............................................................................. 19 B. Regional Mill Levy Imposition............................................................................. 19 C. City Notice Regarding Regional Improvements................................................... 19 D. Regional Improvements Authorized Under Service Plan..................................... 19 E. Expenditure of Regional Mil Levy Revenues....................................................... 20 1. Intergovernmental Agreement .................................................................. 20 2. No Intergovernmental Agreement ............................................................ 20 F. Regional Mill Levy Term. .................................................................................... 20 G. Completion of Regional Improvements................................................................ 20 H. City Authority to Require Imposition................................................................... 20 I. Regional Mill Levy Not Included in Other Mill Levies. ...................................... 20 J. Gallagher Adjustment. .......................................................................................... 20 XI. CITY FEES....................................................................................................................... 21 iii XII. BANKRUPTCY LIMITATIONS..................................................................................... 21 XIII. ANNUAL REPORTS AND BOARD MEETINGS ......................................................... 21 A. General.................................................................................................................. 21 B. Board Meetings..................................................................................................... 21 C. Report Requirements. ........................................................................................... 22 1. Narrative ................................................................................................... 22 2. Financial Statements ................................................................................. 22 3. Capital Expenditures................................................................................. 22 4. Financial Obligations................................................................................ 22 5. Board Contact Information ....................................................................... 22 6. Other Information ..................................................................................... 22 D. Reporting of Significant Events............................................................................ 22 E. Failure to Submit................................................................................................... 23 XIV. SERVICE PLAN AMENDMENTS ................................................................................. 23 XV. MATERIAL MODIFICATIONS ..................................................................................... 24 XVI. DISSOLUTION................................................................................................................ 24 XVII. SANCTIONS.................................................................................................................... 25 XVIII. INTERGOVERNMENTAL AGREEMENT WITH CITY.............................................. 25 XIX. CONCLUSION................................................................................................................. 25 XX. RESOLUTION OF APPROVAL ..................................................................................... 26 iv EXHIBITS EXHIBIT A-1 Legal Description of District Model Service Plan for Multiple DistrictsNo. 1 Boundaries REVISED EXHIBIT A-2-5-19 This model service plan template should be referenced in conjunction with the City Legal Description of Fort Collins Policy for Reviewing Service Plans for Metropolitan Districts. v Table of Contents INTRODUCTION................................................................................................................5 Purpose and Intent..............................................................................................................5 Need for District 5No. 2 Boundaries Objective of the City regarding District’s Service Plan.....................................................6 Relevant Intergovernmental Agreements ..........................................................................6 City Approvals...................................................................................................................6 DEFINITIONS .....................................................................................................................6 BOUNDARIES AND LOCATION ....................................................................................9 DESCRIPTION OF PROJECT, PLANNED DEVELOPMENT, PUBLIC BENEFIT & ASSESSED VALUATION10 Project and Planned Development .....................................................................................10 EXHIBIT A-3 Legal Description of District No. 3 Boundaries EXHIBIT B-1 District No. 1 Boundary Map EXHIBIT B-2 District No. 2 Boundary Map EXHIBIT B-3 District No. 3 Boundary Map EXHIBIT C Vicinity Map EXHIBIT D Public Benefits 10Improvement Cost Estimates Assessed Valuation ............................................................................................................11 INCLUSION OF LAND IN THE SERVICE AREA........................................................11 DISTRICT GOVERNANCE ..............................................................................................11 AUTHORIZED AND PROHIBITED POWERS..............................................................11 General Grant of Powers....................................................................................................11 Prohibited Improvements and Services and other Restrictions and Limitations................12 Eminent Domain Restriction .....................................................................................12 Fee Limitation ...........................................................................................................12 Operations and Maintenance......................................................................................12 Fire Protection Restriction.........................................................................................13 EXHIBIT E Public Safety Services Restriction 13Improvement Maps Grants from Governmental Agencies Restriction......................................................13 Golf Course Construction Restriction........................................................................13 Television Relay and Translation Restriction............................................................13 Potable Water and Wastewater Treatment Facilities.................................................13 Sales and Use Tax Exemption Limitation .................................................................13 Sub-district Restriction .............................................................................................14 Privately Placed Debt Limitation ..............................................................................14 Special Assessments ..................................................................................................14 PUBLIC IMPROVEMENTS AND ESTIMATED COSTS.............................................14 vi Development Standards......................................................................................................15 Contracting.........................................................................................................................15 Land Acquisition and Conveyance ....................................................................................15 Equal Employment and Discrimination .............................................................................16 FINANCIAL PLAN/PROPOSED DEBT ..........................................................................16 EXHIBIT F Financial Plan 16 Mill Levies .........................................................................................................................16 Aggregate Mill Levy Maximum................................................................................17 Regional Mill Levy Not Included in Other Mill Levies ............................................17 Operating Mill Levy ..................................................................................................17 Gallagher Adjustments...............................................................................................17 Excessive Mill Levy Pledges.....................................................................................17 Refunding Debt..........................................................................................................17 Maximum Debt Authorization...................................................................................17 Maximum Voted Interest Rate and Underwriting Discount ..............................................18 Interest Rate and Underwriting Discount Certification......................................................18 EXHIBIT G Public Benefits EXHIBIT H........................................................................................................................ ............................................................................................................................................Disclos ure to Purchasers ................................................................................................................18 External Financial Advisor.................................................................................................18 Disclosure to Debt Purchasers............................................................................................19 Security for Debt ................................................................................................................19 TABOR Compliance..........................................................................................................19 District’s Operating Costs ..................................................................................................19 Regional Improvements.......................................................................................................20 Regional Mill Levy Authority............................................................................................20 Regional Mill Levy Imposition..........................................................................................20 City Notice Regarding Regional Improvements 20 Regional Improvements Authorized Under Service Plan ..................................................20 Expenditure of Regional Mill Levy Revenues...................................................................20 Intergovernmental Agreement ...................................................................................20 No EXHIBIT I Form of Intergovernmental Agreement 21 Regional Mill Levy Term...................................................................................................21 Completion of Regional Improvements .............................................................................21 City Authority to Require Imposition ................................................................................21 Regional Mill Levy Not Included in Other Mill Levies.....................................................21 vii Gallagher Adjustment ........................................................................................................21 City Fees................................................................................................................................21 Bankruptcy Limitations ......................................................................................................21 Annual Reports and Board Meetings.................................................................................22 General ...............................................................................................................................22 Board Meetings..................................................................................................................22 Report Requirements..........................................................................................................22 Narrative ....................................................................................................................22 Financial Statements .................................................................................................22 Capital Expenditures .................................................................................................22 Financial Obligations.................................................................................................22 Board Contact Information ........................................................................................23 Other Information ......................................................................................................23 Reporting of Significant Events .........................................................................................23 Failure to Submit................................................................................................................23 Service Plan Amendments...................................................................................................23 Material Modifications ........................................................................................................24 Dissolution ............................................................................................................................24 Sanctions ...............................................................................................................................25 Intergovernmental Agreement with City...........................................................................25 Conclusion ............................................................................................................................25 Resolution of Approval........................................................................................................26 viii 1 I. INTRODUCTION B.A. Purpose and Intent. The Districts, which are intended to be independent units of local government separate and distinct from the City, are governed by this Service Plan, the Special District Act and other applicable State law. Except as may otherwise be provided by State law, City Code or this Service Plan, the Districts’ activities are subject to review and approval by the City Council only insofar as they are a material modification of this Service Plan under C.R.S. Section 32-1-207 of the Special District Act. It is intended that the Districts will provide all or part of the Public Improvements for the Project for the use and benefit of all anticipated inhabitants and taxpayers of the DistrictDistricts. The primary purpose of the Districts will be to finance the construction of these Public Improvements by the issuance of Debt. It is also intended under this Service Plan that no District shall be authorized to issue any Debt, impose a Debt Mill Levy, Operating Mill Levy or impose any Fees for payment of theon Debt unless and until the delivery of the applicable Public Benefits described in Section IV.B. of this Service Plan has been secured in accordance with Section IV.B. of this Service Plan. It is further intended that this Service Plan also requires the Districts to pay a portion of the cost of the Regional Improvements, as provided in Section X of this Service Plan, as part of ensuring that those privately-owned properties to be developed in the DistrictDistricts that benefit from the Regional Improvements pay a reasonable share of the associated costs. The Districts are not intended to provide ongoing operations and maintenance services except as expressly authorized in this Service Plan. It is the intent of the Districts to dissolve upon payment or defeasance of all Debt incurred or upon a court determination that adequate provision has been made for the payment of all Debt, except that if the Districts are authorized in this Service Plan to perform continuing operating or maintenance functions, the Districts shall continue in existence for the sole purpose of providing such functions and shall retain only the powers necessary to impose and collect the taxes or Fees authorized in this Service Plan to pay for the costs of those functions. It is intended that the Districts shall comply with the provisions of this Service Plan and that the City may enforce any non-compliance with these provisions as provided in SectionSections XVII and XVIII of this Service Plan. 2 D.B. Need for the Districts. There are currently no other governmental entities, including the City, located in the immediate vicinity of the Districts that consider it desirable, feasible or practical to undertake the planning, design, acquisition, construction, installation, relocation, redevelopment and financing of the Public Improvements needed for the Project. Formation of the Districts is therefore necessary in order for the Public Improvements required for the Project to be provided in the most economic manner possible. F.C. Objective of the City Regarding Districts’ Service Plan. The City’s objective in approving this Service Plan is to authorize the Districts to provide for the planning, design, acquisition, construction, installation, relocation and redevelopment of the Public Improvements from the proceeds of Debt to be issued by the Districts but in doing so, to also establish in thisthe Service Plan the means by which both the Regional Improvements and the Public Benefits will be provided. Except as specifically provided in this Service Plan, all Debt is expected to be repaid by taxes and Fees imposed and collected for no longer than the Maximum Debt Mill Levy Imposition Term for residential properties, and at a tax mill levy no higher than the Maximum Debt Mill Levy. Fees imposed for the payment of Debt shall be due no later than upon the issuance of a building permit unless a majority of the Board which imposes such a Fee is composed of End Users as provided in Section VII.B.2 of this Service Plan.. Debt which is issued within these parameters and, as further described in the Financial Plan, will insulate property owners from excessive tax and Fee burdens to support the servicing of the Debt and will result in a timely and reasonable discharge of the Debt. G. Relevant Intergovernmental Agreements. [Add description of any relevant intergovernmental agreements.] D. E. City Approvals. Any provision in this Service Plan requiring “City” or “City Council” approval or consent shall require the City Council’s prior written approval or consent exercised in its sole discretion. Any provision in this Service Plan requiring “City Manager” approval or consent shall require the City Manager’s prior written approval or consent exercised in the City Manager’s sole discretion. III.II. DEFINITIONS In this Service Plan, the following words, terms and phrases which appear in a capitalized format shall have the meaning indicated below, unless the context clearly requires otherwise: 3 Aggregate Mill Levy: means the total mill levy resulting from adding the Districts’a District’s Debt Mill Levy and Operating Mill Levy. The Districts’ A District’s Aggregate Mill Levy does not include any Regional Mill Levy that the District may levy. Aggregate Mill Levy Maximum: means the maximum number of combined mills that the Districts may each levy for theirits Debt Mill Levy and Operating Mill Levy, at a rate not to exceed the limitation set in Section IX.B.1 of this Service Plan. Approved Development Plan: means a City-approved development plan or other land- use application required by the City Code for identifying, among other things, public improvements necessary for facilitating the development of property within the Service Area, which plan shall include, without limitation, any development agreement required by the City Code. Board or Boards: means the duly constituted Board or board of directors of each of the Districts, or the Boards of Directors of the Districts, or the boards of directors of all of the Districts, in the aggregate. Bond, Bonds or Debt: means bonds, notes or other multiple fiscal year financial obligations for the payment of which a District has promised to impose an ad valorem property tax mill levy, Fees or other legally available revenue. Such terms do not include contracts through which a District procures or provides services or tangible property. City: means the City of Fort Collins, Colorado, a home rule municipality. City Code: means collectively the City’s Municipal Charter, Municipal Code, Land Use Code and ordinances as all are now existing and hereafter amended. City Council: means the City Council of the City. City Manager: means the City Manager of the City. C.R.S.: means the Colorado Revised Statutes. Debt Mill Levy: means a property tax mill levy imposed on Taxable Property by the Districtswithin a District for the purpose of paying Debt as authorized in this Service Plan, at a rate not to exceed the limitations set in Section IX.B of this Service Plan. Developer: means a person or entity that is the owner of property or owner of contractual rights to property in the Service Area that intends to develop the property. District: means any one of the [Names of Districts], individually,following metropolitan districts: Northfield Metropolitan District No. 1, Northfield Metropolitan District No. 2 and Northfield Metropolitan District No. 3, as each are organized under and governed by this Service Plan. 4 Districts: means the [Names of Districts], collectively, organized and governed under this Service Plan. District No. 1 Boundaries: means the boundaries of the area legally described in Exhibit “A-1” attached hereto and incorporated by reference and as depicted in the District No. 1 Boundary Map. District No. 2 Boundaries: means the boundaries of the area legally described in Exhibit “A-2” attached hereto and incorporated by reference and as depicted in the District No. 2 Boundary Map. District No. 3 Boundaries: means the boundaries of the area legally described in Exhibit “A-3” attached hereto and incorporated by reference and as depicted in the District No. 3 Boundary Map. District No. 1 Boundary Map: means the map of the District No. 1 Boundaries attached hereto as Exhibit “B-1” and incorporated by reference. District No. 2 Boundary Map: means the map of the District No. 2 Boundaries attached hereto as Exhibit “B-2” and incorporated by reference. District No. 3 Boundary Map: means the map of the District No. 3 Boundaries attached hereto as Exhibit “B-3” and incorporated by reference. Districts: means Northfield Metropolitan District No. 1, Northfield Metropolitan District No. 2 and Northfield Metropolitan District No. 3, collectively, organized under and governed by this Service Plan. End User: means any owner, or tenant of any owner, of any property within the Districts, who is intended to become burdened by the imposition of ad valorem property taxes and/or Fees. By way of illustration, a resident homeowner, renter, commercial property owner or commercial tenant is an End User. A Developer and any person or entity that constructs homes or commercial structures is not an End User. External Financial Advisor: means a consultant that: (1) is qualified to advise Colorado governmental entities on matters relating to the issuance of securities by Colorado governmental entities including matters such as the pricing, sales and marketing of such securities and the procuring of bond ratings, credit enhancement and insurance in respect of such securities; (2) shall be an underwriter, investment banker, or individual listed as a public finance advisor in the Bond Buyer’s Municipal Market Place or, in the City’s sole discretion, other recognized publication as a provider of financial projections; and (3) is not an officer or employee of the Districts or an underwriter of the Districts’ Debt. Fees: means the fees, rates, tolls, penalties and charges the Districts are authorized to impose and collect under this Service Plan. Financial Plan: means the Financial Plan described in Section IX of this Service Plan which was prepared or approved by [Name],D.A. Davidson & Co., an External Financial Advisor, 5 in accordance with the requirements of this Service Plan and describes (a) how the Public Improvements are to be financed; (b) how the Debt is expected to be incurred; and (c) the estimated operating revenue derived from property taxes and any Fees for the first budget year through the year in which all District Debt is expected to be defeased or paid in the ordinary course. Inclusion Area Boundaries: means the boundaries of the property that is anticipated to be added to the Districts’ Boundaries after the Districts’ organization, which property is legally described in Exhibit “C” attached hereto and incorporated by reference and depicted in the map attached hereto as Exhibit “D” and incorporated herein by reference. Maximum Debt Authorization: means the total Debt the Districts are permitted to issue as set forth in Section IX.B.7 of this Service Plan. Maximum Debt Mill Levy Imposition Term: means the maximum term during which the Districts’a District’s Debt Mill Levy may be imposed on property developed in the Service Area for residential use, which shall include residential properties in mixed-use developments. This maximum term shall not exceed forty (40) years from December 31 of the year this Service Plan is approved by City Council Operating Mill Levy: means a property tax mill levy imposed on Taxable Property for the purpose of funding the Districts’a District’s administration, operations and maintenance as authorized in this Service Plan, including, without limitation, repair and replacement of Public Improvements, and imposed at a rate not to exceed the limitations set in Section IX.B of this Service Plan. Planned Development: means the private development or redevelopment of the properties in the Service Area, commonly referred to as the [Name] developmentNorthfield, under an Approved Development Plan. Project: means the installation and construction of the Public Improvements for the Planned Development. Public Improvements: means the improvements and infrastructure the Districts are authorized by this Service Plan to fund and construct for the Planned Development to serve the future taxpayers and inhabitants of the Districts, except as specifically prohibited or limited in this Service Plan. Public Improvements shall include, without limitation, the improvements and infrastructure described in Exhibit “E”F attached hereto and incorporated by reference. Public Improvements do not include Regional Improvements. Regional Improvements: means any regional public improvement identified by the City, as provided in Section X of this Service Plan, for funding, in whole or part, by a Regional Mill Levy levied by the Districts, including, without limitation, the public improvements described in Exhibit “F”I attached hereto and incorporated by reference. Regional Mill Levy: means the property tax mill levy imposed on Taxable Property for the purpose of planning, designing, acquiring, funding, constructing, installing, relocating and/or redeveloping the Regional Improvements and/or to fund the administration and overhead costs related to the Regional Improvements as provided in Section X of this Service Plan. 6 Service Area: means the property collectively within the District No. 1 Boundaries, the District No. 2 Boundaries, theand District No. 3 Boundaries and the property, all as may be amended from time to time as further set forth in the Inclusion Area Boundaries when it is added, in whole or partthis Service Plan and the Special District Act. Special District Act: means Article 1 in Title 32 of the Colorado Revised Statutes, as amended. Service Plan: means this service plan for the Districts approved by the City Council. Service Plan Amendment: means a material modification of the Service Plan approved by the City Council in accordance with the Special District Act, this Service Plan and any other applicable law. State: means the State of Colorado. TABOR: means Colorado’s Taxpayer’s Bill of Rights in Article X, Section 20 of the Colorado Constitution. Taxable Property: means the real and personal property within the Service Area that will be subject to the ad valorem property taxes imposed by the Districts. TABOR: means Colorado’s Taxpayer’s Bill of Rights in Article X, Section 20 of the Colorado Constitution. Vicinity Map: means the map attached hereto as Exhibit “G”E and incorporated by reference depicting the location of the Service Area within the regional area surrounding it. IV.III. BOUNDARIES AND LOCATION The area of the Service Area, without the Inclusion Area Boundaries, includes approximately [Insert Number] 56.3 acres and the total area proposed to be included in the Inclusion Area Boundaries is approximately [Insert Number] acres.. A legal description and map of each of the Districts’ boundariesDistrict No. 1 Boundaries are attached hereto as ExhibitsExhibit A-1, A-2 and A-3 and Exhibit B-1, B-2 and B-3, respectively. A; a legal description and map of the Inclusion AreaDistrict No. 2 Boundaries are attached hereto as Exhibit CA-2 and Exhibit DB-2, respectively.; and a legal description and map of the District No. 3 Boundaries are attached hereto as Exhibit A-3 and Exhibit B-3, respectively. It is anticipated that the boundaries of the DistrictsDistricts’ Boundaries may expand or contract from time to time as the Districts undertake inclusions or exclusions pursuant to the Special District Act, subject to the limitations set forth in Section V of this Service Plan. The location of the Service Area is depicted in the vicinity map attached as Exhibit GE. VI.IV. DESCRIPTION OF PROJECT, PLANNED DEVELOPMENT, PUBLIC BENEFITS & ASSESSED VALUATION 7 B.A. Project and Planned Development. [Describe the nature of the Project and Planned Development, estimated population at build out, timeline for development, estimated assessed value after 5 and 10 years and estimated sales tax revenue. Also, please identify all plans, including but not limited to Citywide Plans, Small Area Plans, and General Development Plans that apply to any portion of the Districts’ Boundaries or Inclusion Area Boundaries and describe how the Project and Planned Development are consistent with the applicable plans. Please state if the proposed Districts are to be located within an urban renewal area and if the proposed development is anticipating the use of tax increment financing (TIF). If the Districts intend to pursue TIF, please provide information on how the TIF financing will interact with the Districts’ financing and how the necessary Public Improvements will be shared across the two funding sources.] Situated within walking distance of the City’s Old Town, the PlannedDevelopment is a proposed 56.3-acre, mixed-use community located west of Lindenmeier Road, southeast of the Lake Canal and north of the to-be designated historic Alta Vista neighborhood. The Planned Development targets a number of the City’s stretch outcomes and critical objectives, including neighborhood livability and social health, environmental health, and transportation. The Planned Development incorporates goals of the following plans: the City Plan, Transportation Master Plan, Master Street Plan, Nature in the City Strategic Plan, Natural Areas Master Plan, Paved Recreational Trail Master Plan, Northside Neighborhoods Plan, Pedestrian Plan, and Bicycle Master Plan. The Planned Development is anticipated to include approximately 442 attached housing units, of which a minimum of sixty-five (65) housing units will be designated as affordable housing, either for-sale or for-rent, and the majority of the rest of the units will be sold as attainable housing units. The Planned Development is also anticipated to include a mixed-use center that will offer light commercial use on the first floor, residential for-rent units on the second floor, and small amenities open to the public. The estimated resident population at build-out is 1,139. Construction of the Planned Development is planned to be completed by year 2026. In accordance with the Financial Plan, the estimated assessed valuation of the Planned Development in 2024 is estimated to be $8,525,353 for residential and $181,867 for commercial, and in 2029 it is estimated to be $13,129,996 for residential and $204,346 for commercial. Approval of this Service Plan by the City Council does not constitute nor imply approval of the development of any particular land-use for any specific area within the Districts. Any such approval must be contained within an Approved Development Plan. D.B. Public Benefits. In addition to providing a portion of the Public Improvements described in Exhibit F and the Regional Improvements, the organization of the Districts is intended to enable the Project towill deliver a number of extraordinary direct and indirectseveral public benefits, including: [Describe Public Benefits] (collectively, the “Public Benefits”). The Public Benefits to be enabled 8 under this to the community in accordance with the City’s Metro District Service Plan Policy. The public benefits include, but are not limited to, developing critical on-site and off-site public infrastructure, employing high quality and smart growth practices, creating affordable housing units, creating attainable housing units to support the workforce, and incorporating environmental sustainability through energy and water conservation, and enhanced multimodal transportation, all of which are specifically described in Exhibit JI attached hereto and incorporated herein by this reference. (collectively, the “Public Benefits”). Therefore, notwithstanding any provision to the contrary contained in this Service Plan, no District shall be authorized to issue any Debt or to impose a Debt Mill Levy or any Fees for payment of Debt unless and until the delivery of the Public Benefits specifically related to the phase of the Planned Development of aor portion of the Project to be financed with such Debt, Debt Mill Levy or Fees, are secured in a manner approved by the City Council. To satisfy this precondition to the issuance of Debt and to the imposition of the Debt Mill Levy and Fees, delivery of the Public Benefits for each phase of the Project and the Planned Development must be secured by one of the following methods, as applicable: 2.1. For any portion of the Public Benefits to be provided by one or more of the Districts, each such District must enter into an intergovernmental agreement with the City by either (i) agreeing to provide those Public Benefits as a legally enforceable multiple-fiscal year obligation of the District under TABOR, or by (ii) securing performance of that obligation with a surety bond, letter of credit, or other security acceptable to the City, and any such intergovernmental agreement must be approved by the City Council by resolution; 4.2. For any portion of the Public Benefits to be provided by one or more Developers of the Planned Development, each such Developer must either (i) enter into a development agreement with the City under the Developer’s applicable Approved Development Plan, which agreement must legally obligate the Developer to provide those Public Benefits before the City is required to issue building permits and/or certificates of occupancy for structures to be built under the Approved Development Plan for that phase of the Planned Development, or (ii) secure such obligations with a surety bond, letter of credit, or other security acceptable to the City, and all such development agreements must be approved by the City Council by resolution; or 6.3. For any portion of the Public Benefits to be provided in part by one or more of the Districts in the Project and in part by one or more of the Developers in the Planned Development or Project, an agreement between the City and, the affected District(s)), and Developersthe Developer(s) that secures such Public Benefits as legally binding obligations using the methods described in subsections 1 and 2 above, and all such agreements must be approved by the City Council by resolution. F.C. Assessed Valuation. 9 The current assessed valuation of the Service Area is approximately [Dollar Amount]$2,024 and, at build out, is expected to be [Dollar Amount].$13,334,342. These amounts are expected to be sufficient to reasonably discharge the Debt as demonstrated in the Financial Plan. VII.V. INCLUSION OF LAND IN THE SERVICE AREA Other than the real property in the Inclusion Area Boundaries, the DistrictThe Districts shall not includeadd any real property intoto the Service Area without the City Council’s prior writtenCity’s approval and in compliance with the Special District Act. Once thea District has issued Debt, it shall not exclude real property from the Districts’District’s boundaries without the prior written consent of the City Council. VIII.VI. DISTRICT GOVERNANCE The Districts’ Boards shall be comprised of persons who are a qualified “eligible electorselector” of the Districts as provided in the Special District Act. It is anticipated that, over time, the End Users who are eligible electors will assume direct electoral control of the Districts’ Boards as development of the Service Area progresses. The Districts shall not enter into any agreement by which the End Users’ electoral control of any of the Boards is removed or diminished. IX.VII. AUTHORIZED AND PROHIBITED POWERS B.A. General Grant of Powers. The Districts shall have the power and authority to provide the Public Improvements, the Regional Improvements and related operation and maintenance services, including design review and covenant enforcement services, within and without the Service Area, as such powers and authorities are described in the Special District Act, other applicable State law, common law and the Colorado Constitution, subject to the prohibitions, restrictions and limitations set forth in this Service Plan. If, after the Service Plan is approved, any State law is enacted to grant additional powers or authority to metropolitan districts by amendment of the Special District Act or otherwise, such powers and authority shall not be deemed to be a part hereof. These new powers and authority shall only be available to be exercised by the Districts if the City Council first approves a Service Plan Amendment to specifically allow the exercise of such powers or authority by the Districts. B. B. Prohibited Improvements and Services and other Restrictions and Limitations. 10 The Districts’ powers and authority under this Service Plan to provide Public Improvements and services and to otherwise exercise its other powers and authority under the Special District Act and other applicable State law, are prohibited, restricted and limited as hereafter provided. Failure to comply with these prohibitions, restrictions and limitations shall constitute a material modification under this Service Plan and shall entitle the City to pursue all remedies available at law and in equity as provided in Sections XVII and XVIII of this Service Plan: 1. Eminent Domain Restriction The Districts shall not exercise their statutory power of eminent domain without first obtaining resolution approval from the City Council. This restriction on the Districts’ exercise of thetheir eminent domain power is being voluntarily acquiesced to by the Districts and shall not be interpreted in any way as a limitation on the Districts’ sovereign powers and shall not negatively affect the Districts’ status as a political subdivisionsubdivisions of the State as conferred by the Special District Act. 2. Fee Limitation Any Fees imposed for the repayment of Debt, if authorized by this Service Plan, shall not be imposed by the Districts upon or collected from an End User. In addition, Fees imposed for the payment of Debt shall not be imposed unless and until the requirements for securing the delivery of the District’s portion of the Public Benefits have been satisfied in accordance with Section IV.B of this Service Plan. Notwithstanding the foregoing, this Fee limitation shall not apply to any Fee imposed to fund the operation, maintenance, repair or replacement of Public Improvements or the administration of the Districts. 3. Operations and Maintenance The primary purpose of the Districts is to plan for, design, acquire, construct, install, relocate, redevelop and finance the Public Improvements. The Districts shall dedicate the Public Improvements to the City or other appropriate jurisdiction or owners’ association in a manner consistent with the Approved Development Plan and the City Code, provided that nothing herein requires the City to accept a dedication. The Districts are each specifically authorized to operate and maintain all or any part or all of the Public Improvements not otherwise conveyed or dedicated to the City or another appropriate governmental entity until the such time as the District is dissolved. 4. Fire Protection Restriction The Districts are not authorized to plan for, design, acquire, construct, install, relocate, redevelop, finance, own, operate or maintain fire protection facilities or services, 11 unless such facilities and services are provided pursuant to an intergovernmental agreement with the Poudre Fire Authority. The authority to plan for, design, acquire, construct, install, relocate, redevelop, finance,own, operate or maintain fire hydrants and related improvements installed as part of the Project’s water system shall not be limited by this subsection. 5. Public Safety Services Restriction The Districts are not authorized to provide policing or other security services. However, the DistrictDistricts may, pursuant to C.R.S. § 32-1-1004(7), as amended, furnish security services pursuant to an intergovernmental agreement with the City. 6. Grants from Governmental Agencies Restriction The Districts shall not apply for grant funds distributed by any agency of the United States Government or the State without the prior written approval of the City Manager. This does not restrict the collection of Fees for services provided by the Districts to the United States Government or the State. 7. Golf Course Construction Restriction Acknowledging that the City has financed public golf courses and desires to coordinate the construction of public golf courses within the City’s boundaries, the Districts shall not be authorized to plan, design, acquire, construct, install, relocate, redevelop, finance, own, operate or maintain a golf course unless such activity is pursuant to an intergovernmental agreement with the City approved by the City Council. 8. Television Relay and Translation Restriction The Districts are not authorized to plan for, design, acquire, construct, install, relocate, redevelop, finance, own, operate or maintain television relay and translation facilities and services, other than for the installation of conduit as a part of a street construction project, unless such facilities and services are provided pursuant to prior written approval from the City Council as a Service Plan Amendment. 9. Potable Water and Wastewater Treatment Facilities Acknowledging that the City and other existing special districts operating within the City currently own and operate treatment facilities for potable water and wastewater that are available to provide services to the Service Area, the Districts shall not plan, design, acquire, construct, install, relocate, redevelop, finance, own, operate or maintain such facilities without obtaining the City Council’s prior written approval either by intergovernmental agreement or as a Service Plan Amendment. 12 11.10. Sales and Use Tax Exemption Limitation The Districts shall not exercise any sales and use tax exemption otherwise available to the Districts under the City Code. 12.11. Sub-district Restriction The Districts shall not create any sub-district pursuant to the Special District Act without the prior written approval of the City Council. 13.12. Privately Placed Debt Limitation Prior to the issuance of any privately placed Debt, the Districts shall obtain the certification of an External Financial Advisor substantially as follows: We are [I am] an External Financial Advisor within the meaning of the District’s Service Plan. We [I] certify that (1) the net effective interest rate (calculated as defined in C.R.S. Section 32-1- 103(12)) to be borne by [insert the designation of the Debt] does not exceed a reasonable current [tax- exempt] [taxable] interest rate, using criteria deemed appropriate by us [me] and based upon our [my] analysis of comparable high yield securities; and (2) the structure of [insert designation of the Debt], including maturities and early redemption provisions, is reasonable considering the financial circumstances of the District. 14.13. Special Assessments The Districts shall not impose special assessments without the prior written approval of the City Council. XI.VIII. PUBLIC IMPROVEMENTS AND ESTIMATED COSTS Exhibit EF summarizes the type of Public Improvements that are projected to be constructed and/or installed by the Districts. The cost, scope, and definition of such Public Improvements may vary over time. The total estimated costs of Public Improvements, as set forth in Exhibit HF, excluding any improvements paid for by the Regional Mill Levy necessary to serve the Planned Development, are approximately [Dollar Amount] in [Year] dollars and total 13 approximately [Dollar Amount] in the anticipated year of construction dollars.$30,101,665 in 2019 dollars. The cost estimates are based upon preliminary engineering, architectural surveys, and reviews of the Public Improvements set forth in Exhibit EF and include all construction cost estimates together with estimates of costs such as land acquisition, engineering services, legal expenses and other associated expenses. Maps of the anticipated location, operation, and maintenance of Public Improvements are attached hereto as Exhibit I.G. Changes in the Public Improvements or cost, which are approved by the City in an Approved Development Plan and any agreement approved by the City Council pursuant to Section IV.B of this Service Plan, shall not constitute a Service Plan Amendment. In addition, due to the preliminary nature of the Project, the City shall not be bound by this Service Plan in reviewing and approving the Approved Development Plan and the Approved Development Plan shall supersede the Service Plan with regard to the cost, scope, and definition of Public Improvements. Provided, however, any agreement approved and entered into underpursuant to Section IV.B of this Service Plan for the provision of a Public Improvement that is also a Public Benefit, shall supersede both this Service Plan and the applicable Approved Development Plan. Except as otherwise provided by an agreement approved under Section IV.B of this Service Plan: (i) the design, phasing of construction, location and completion of Public Improvements will be determined by the Districts to coincide with the phasing and development of the Planned Development and the availability of funding sources; (ii) the Districts may, in their discretion, phase the construction, completion, operation, and maintenance of Public Improvements or defer, delay, reschedule, rephase, relocate or determine not to proceed with the construction, completion, operation, and maintenance of Public Improvements, and such actions or determinations shall not constitute a Service Plan Amendment; and (iii) the DistrictDistricts shall also be permitted to allocate costs between such categories of the Public Improvements as deemed necessary in its discretiontheir discretion; and (iv) to the extent that the City reimburses a developer for Public Improvements that would otherwise be reimbursable under the Special District Act, the District shall not reimburse the developer for such Public Improvements. The Public Improvements shall be listed using an ownership and maintenance matrix in Exhibit EF, either individually or categorically, to identify the ownership and maintenance responsibilities of the Public Improvements. The City Code has development standards, contracting requirements and other legal requirements related to the construction and payment of public improvements and related to certain operation activities. Relating to these, the Districts shall comply with the following requirements: A. Development Standards. The Districts shall ensure that the Public Improvements are designed and constructed in accordance with the standards and specifications of the City Code and of other governmental entities having proper jurisdiction, as applicable. The Districts directly, or indirectly through any Developer, will obtain the City’s approval of civil engineering plans and will obtain applicable permits for construction and installation of Public Improvements prior to performing such work. Unless waived by the City Council, the Districts shall be required, in accordance with the City Code, to post a surety bond, letter of credit, or other approved development security for any Public Improvements to be constructed by the Districts. Such development security may be 14 released in the City ManagersManager’s discretion when the constructing District has obtained funds, through Debt issuance or otherwise, adequate to insure the construction of the Public Improvements, unless such release is prohibited by or in conflict with any City Code provision, State law or any agreement approved and entered into under Section IV.B of this Service Plan. Any limitation or requirement concerning the time within which the City must review the Districts’ proposalsproposal or applicationsapplication for an Approved Development Plan or other land use approval is hereby waived by the Districts. B. Contracting. The Districts shall comply with all applicable State purchasing, public bidding and construction contracting requirements and limitations. C. Land Acquisition and Conveyance. The purchase price of any land or improvements acquired by the Districts from the Developer shall be no more than the then-current fair market value as confirmed by an independent MAI appraisal for land and by an independent professional engineer for improvements. Land, easements, improvements and facilities conveyed to the City shall be free and clear of all liens, encumbrances and easements, unless otherwise approved by the City Manager prior to conveyance. All conveyances to the City shall be by special warranty deed, shall be conveyed at no cost to the City, shall include an ALTA title policy issued to the City, shall meet the environmental standards of the City and shall comply with any other conveyance prerequisites required in the City Code. D. Equal Employment and Discrimination. In connection with the performance of all acts or activities hereunder, the Districts shall not discriminate against any person otherwise qualified with respect to its hiring, discharging, promoting or demoting or in matters of compensation solely because of race, color, religion, national origin, gender, age, military status, sexual orientation, gender identity or gender expression, marital status, or physical or mental disability, and further shall insert the foregoing provision in contracts or subcontracts entered into by the Districts to accomplish the purposes of this Service Plan. XIII.IX. FINANCIAL PLAN/PROPOSED DEBT This Section IX of the Service Plan describes the nature, basis, method of funding and financing limitations associated with the acquisition, construction, completion, repair, replacement, operation and maintenance of Public Improvements. A. Financial Plan. The Districts’ Financial Plan, attached as Exhibit JH and incorporated by reference, reflects the Districts’ anticipated schedule for incurring Debt to fund Public 15 Improvements in support of the Project. The Financial Plan also reflects the schedule of all anticipated revenues flowing to the Districts derived from the Districts’ mill levies, Fees imposed by the Districts, specific ownership taxes, and all other anticipated legally available revenues. The Financial Plan is based on economic, political and industry conditions as they presently exist and reasonable projections and estimates of future conditions. These projections and estimates are not to be interpreted as the only method of implementation of the District’s goals and objectives but rather a representation of one feasible alternative. Other financial structures may be used so long as they are in compliance with this Service Plan. The Financial Plan incorporates all of the provisions of this ArticleSection IX. Based upon the assumptions contained therein, the Financial Plan projects the issuance of Bonds to fund Public Improvements and anticipated Debt repayment based on the development assumptions and absorptions of the property in the Service Area by End Users. The Financial Plan anticipates that the Districts will acquire, construct, and complete all Public Improvements needed to serve the Service Area. The Financial Plan demonstrates that the Districts will have the financial ability to discharge all Debt to be issued as part of the Financial Plan on a reasonable basis. Furthermore, the Districts will secure the certification of an External Financial Advisor who will provide an opinion as to whether such Debt issuances are in the best interest of the Districts at the time of issuance. B. Mill Levies. It is anticipated that the Districts will impose a Debt Mill Levy and an Operating Mill Levy on all property within the Service Area. In doing so, the following shall apply: 1. Aggregate Mill Levy Maximum The Aggregate Mill Levy shall not exceed in any year the Aggregate Mill Levy Maximum, which is fifty (50) mills. 2. Regional Mill Levy Not Included in Other Mill Levies The Regional Mill Levy shall not be counted against the Aggregate Mill Levy Maximum. 3. Operating Mill Levy The Districts may each impose an Operating Mill Levy of up to fifty (50) mills until the DistrictsDistrict imposes a Debt Mill Levy. Once a District imposes a Debt Mill Levy of any amount, that District’s Operating Mill Levy shall not exceed ten (10) mills at any point. 16 4. Gallagher Adjustments In the event the State’s method of calculating assessed valuation for the Taxable Property changes after January 1, [current year]2019, or any constitutionally mandated tax credit, cut or abatement takes effect after January 1, 2019, the Districts’ Aggregate Mill Levy, Debt Mill Levy, Operating Mill Levy, and Aggregate Mill Levy Maximum, amounts herein provided may be increased or decreased to reflect such changes; such increases or decreases shall be determined by the Districts’ Boards in good faith so that to the extent possible, the actual tax revenues generated by such mill levies, as adjusted, are neither enhanced nor diminished as a result of such change occurring after January 1, [current year].2019. For purposes of the foregoing, a change in the ratio of actual valuation to assessed valuation will be a change in the method of calculating assessed valuation. 5. Excessive Mill Levy Pledges Any Debt issued with a mill levy pledge, or which results in a mill levy pledge, that exceeds the Aggregate Mill Levy Maximum or the Maximum Debt Mill Levy Imposition Term, shall be deemed a material modification of this Service Plan and shall not be an authorized issuance of Debt unless and until such material modification has been approved by a Service Plan Amendment. 6. Refunding Debt The Maximum Debt Mill Levy Imposition Term may be exceeded for Debt refunding purposes if: (1) a majority of the issuing District’s Board is composed of End Users and have voted in favor of a refunding of a part or all of the Debt; or (2) such refunding will result in a net present value savings. 7. Maximum Debt Authorization The Districts anticipate approximately [Dollar Amount]$30,101,665 in project costs in [Year]2019 dollars as set forth in Exhibit EF and anticipate issuing approximately [Dollar Amount]$16,000,000 in Debt to pay such costs as set forth in Exhibit JH, which Debt issuance amount shall be the amount of the Maximum Debt Authorization. In addition, thea District shall not issue any Debt unless and until delivery of the District’s Public Benefits have been secured as required in Section IV.B of this Service Plan. The Districts collectively shall not issue Debt in excess of the Maximum Debt Authorization. Bonds, loans, notes or other instruments Bonds which have been refunded shall not count against the Maximum Debt Authorization. The Districts must obtain from the City Council a Service Plan Amendment prior to issuing Debt in excess of the Maximum Debt Authorization. C. Maximum Voted Interest Rate and Underwriting Discount. 17 The interest rate on any Debt is expected to be the market rate at the time the Debt is issued. The maximum interest rate on any Debt, including any defaulting interest rate, is not permitted to exceed Twelve Percenttwelve percent (12%). The maximum underwriting discount shall be three percent (3%). Debt, when issued, will comply with all relevant requirements of this Service Plan, the Special District Act, other applicable State law and federal law as then applicable to the issuance of public securities. D. Interest Rate and Underwriting Discount Certification. The Districts shall retain an External Financial Advisor to provide a written opinion on the market reasonableness of the interest rate on any Debt and any underwriter discount payed by the Districts as part of a Debt financing transaction. The Districts shall provide this written opinion to the City before issuing any Debt based on it. E. Disclosure to Purchasers. In order to notify future End Users who are purchasing residential lots or dwellings units in the Service Area that they will be paying, in addition to the property taxes owed to other taxing governmental entities, the property taxes imposed under the Debt Mill Levy, the Operating Mill Levy and possibly the Regional Mill Levy, the Districts shall not be authorized to issue any Debt under this Service Plan until there is included in the Developer’s Approved Development Plan provisions that require the following: 1. That the Developer, and its successors and assigns, shall prepare and submit to the City Manager for his approval a disclosure notice in substantially the form attached hereto as Exhibit KH (the “Disclosure Notice”); 2. That when the Disclosure Notice is approved by the City Manager, the Developer shall record the Disclosure Notice in the Larimer County Clerk and Recorders Office; and 3. That the approved Disclosure Notice shall be provided by the Developer, and by its successors and assigns, to each potential End User purchaser of a residential lot or dwelling unit in the Service Area before that purchaser enters into a written agreement for the purchase and sale of that residential lot or dwelling unit. F. External Financial Advisor. An External Financial Advisor shall be retained by the Districts to provide a written opinion as to whether any Debt issuance is in the best interest of the Districtsissuing District once the total amount of Debt issued by the Districtssuch District exceeds Five Million Dollars ($5,000,000). The External Financial Advisor is to provide advice to the Districts’ Boardsissuing District’s Board regarding the proposed terms and whether Debt conditions are reasonable based upon the status of development within the DistrictsDistrict, the projected tax base increase in the 18 DistrictsDistrict, the security offered and other considerations as may be identified by the Advisor. The Districtsissuing District shall include in the transcript of any Bond transaction, or other appropriate financing documentation for related Debt instrument, a signed letter from the External Financial Advisor providing an official opinion on the structure of the Debt, stating the Advisor’s opinion that the cost of issuance, sizing, repayment term, redemption feature, couponing, credit spreads, payment, closing date, and other material transaction details of the proposed Debt serve the best interest of the Districtsissuing District. Debt shall not be undertaken by the Districts if found to be unreasonable by the External Financial Advisor. G. Disclosure to Debt Purchasers. Any Debt of the Districts shall set forth a statement in substantially the following form: “By acceptance of this instrument, the owner of this Debt agrees and consents to all of the limitations with respect to the payment of the principal and interest on this Debt contained herein, in the resolution of the District authorizing the issuance of this Debt and in the Service Plan of the District. This Debt is not and cannot be a Debt of the City of Fort Collins”. Similar language describing the limitations with respect to the payment of the principal and interest on Debt set forth in this Service Plan shall be included in any document used for the offering of the Debt for sale to persons, including, but not limited to, a Developer of property within the Service Area. H. Security for Debt. The Districts shall not pledge any revenue or property of the City as security for the indebtedness set forth in this Service Plan. Approval of this Service Plan shall not be construed as a guarantee by the City of payment of any of the Districts’ obligations; nor shall anything in the Service Plan be construed so as to create any responsibility or liability on the part of the City in the event of default by the Districts in the payment of any such obligationsobligation. I. TABOR Compliance. The Districts shall comply with the provisions of TABOR. In the discretion of the Districts’ Boards, the Districts may set up other qualifying entities to manage, fund, construct and operate facilities, services, and programs. To the extent allowed by law, any entity created by a District will remain under the control of the District’s Board. J. Districts’ Operating Costs. The estimated cost of acquiring land, engineering services, legal services and administrative services, together with the estimated costs of the Districts’ organization and initial 19 operations, are anticipated to be [Dollar Amount],One Hundred Thousand Dollars ($100,000), which will be eligible for reimbursement from Debt proceeds. In addition to the capital costs of the Public Improvements, the Districts will require operating funds for administration and to plan and cause the Public Improvements to be operated and maintained. The first year’s operating budget is estimated to be [Dollar Amount].Fifty Thousand Dollars ($50,000). Ongoing administration, operations and maintenance costs may be paid from property taxes collected through the imposition of an Operating Mill Levy, subject to the limitations set forth in Section IX.B.3, as well as from other revenues legally available to the Districts. XIV.X. REGIONAL IMPROVEMENTS The Districts shall be authorized to provide for the planning, design, acquisition, funding, construction, installation, relocation, redevelopment, administration and overhead costs related to the provision of Regional Improvements. At the discretion of the City, the Districts shall impose a Regional Improvement Mill Levy on all property within the Districts’ Boundaries and any properties thereafter included in the Boundaries under the following terms: A. Regional Mill Levy Authority. The Districts shall seek the authority to impose an additional Regional Mill Levy of five (5) mills as part of the Districts’ initial TABOR election. The Districts shall also seek from the electorate in that election the authority under TABOR to enter into an intergovernmental agreement with the City obligating the Districts to pay as a multiple-fiscal year obligation the proceeds from the Regional Mill Levy to the City. Obtaining such voter-approval of the Regional Mill Levy and this intergovernmental agreement shall be a precondition to the Districts issuing any Debt and imposing the Debt Mill Levy, the Operating Mill Levy and any Fees for the repayment of Debt under this Service Plan. B. Regional Mill Levy Imposition. The Districts shall each impose the Regional Mill Levy at a rate not to exceed five (5) mills within one year of receiving written notice from the City Manager to the Districts requesting the imposition of the Regional Mill Levy and stating the mill levy rate to be imposed. C. City Notice Regarding Regional Improvements. Such notice from the City shall provide a description of the Regional Improvements to be constructed and an analysis explaining how the Regional Improvements will be beneficial to property owners within the Service Area. The City shall make a good faith effort to require that planned developments that (i) are adjacent to the Service Area and (ii) will benefit from the Regional Improvement also impose a Regional MillyMill Levy, to the extent possible. D. Regional Improvements Authorized Under Service Plan. 20 If so notified by the City Manager, the Regional Improvements shall be considered public improvements that the Districts would otherwise be authorized to design, construct, install re-design, re-construct, repair or replace pursuant to this Service Plan and applicable law. E. Expenditure of Regional MillMil Levy Revenues. Revenue collected through the imposition of the Regional Mill Levy shall be expended as follows: 1. Intergovernmental Agreement If the City and the Districts have executed an intergovernmental agreement concerning the Regional Improvements, then the revenue from the Regional Mill Levy shall be used in accordance with such agreement; 2. No Intergovernmental Agreement If no intergovernmental agreement exists between the Districts and the City, then the revenue from the Regional Mill Levy shall be paid to the City, for use by the City in the planning, designing, constructing, installing, acquiring, relocating, redeveloping or financing of Regional Improvements which benefit the End Users of the Districts as prioritized and determined by the City. F. Regional Mill Levy Term. The imposition of the Regional Mill Levy shall not exceed a term of twenty-five (25) years from December 31 of the tax collection year after which the Regional Mill Levy is first imposed. G. Completion of Regional Improvements. All Regional Improvements shall be completed prior to the end of the twenty-five (25) year Regional Mill Levy term. H. City Authority to Require Imposition. The City’s authority to require the initiation ofa District to initiate the imposition of a Regional Mill Levy shall expire fifteen (15) years after December 31st of the year in which the Districtssaid District first imposes a Debt Mill Levy. I. Regional Mill Levy Not Included in Other Mill Levies. The Regional Mill Levy imposed shall not be applied toward the calculation of the Aggregate Mill Levy Maximum. J. Gallagher Adjustment. In the event the method of calculating assessed valuation is changed January 1, [current year],2019, or any constitutionally mandated tax credit, cut or abatement takes effect after 21 January 1, 2019, the Regional Mill Levy may be increased or shall be decreased to reflect such changes; such increases or decreases shall be determined by each of the Districts’ Boards in good faith so that to the extent possible, the actual tax revenues generated by the Regional Mill Levy, as adjusted, are neither enhanced nor diminished as a result of such change occurring after January 1, [current year].2019. For purposes of the foregoing, a change in the ratio of actual valuation to assessed valuation will be a change in the method of calculating assessed valuation. XV.XI. CITY FEES The Districts shall pay all applicable City fees as required by the City Code. XVI.XII. BANKRUPTCY LIMITATIONS All of the limitations contained in this Service Plan, including, but not limited to, those pertaining to the Aggregate Mill Levy Maximum, Maximum Debt Mill Levy Imposition Term and Fees, have been established under the authority of the City in the Special District Act to approve this Service Plan. It is expressly intended that by such approval such limitations: (i) shall not be set aside for any reason, including by judicial action, absent a Service Plan Amendment; and (ii) are, together with all other requirements of State law, included in the “political or governmental powers” reserved to the State under the U.S. Bankruptcy Code (11 U.S.C.) Section 903, and are also included in the “regulatory or electoral approval necessary under applicable non-bankruptcy law” as required for confirmation of a Chapter 9 Bankruptcy Plan under Bankruptcy Code Section 943(b)(6). XVII.XIII. ANNUAL REPORTS AND BOARD MEETINGS A. General. Each of ththe Districts shall be responsible for submitting an annual report to the City Clerk no later than September 1st of each year following the year in which the OrderOrders and DecreeDecrees creating the Districts hashave been issued. The Districts may file a consolidated annual report. The annual report(s) may be made available to the public on the City’s website. B. Board Meetings. Each of the Districts’ Boards shall hold at least one public board meeting in three of the four quarters of each calendar year, beginning in the first full calendar year after the Districts’ creation. Notice for each of these meetings shall be given in accordance with the requirements of the Special District Act and other applicable State law.a District’s creation. This meeting requirement shall not apply until there is at least one End User of property within the District. Also, this requirement shall no longer apply when a majority of the directors on the District’s Board are End Users. Notice for each of these meetings shall be given in accordance with the requirements of the Special District Act and other applicable State Law. 22 C. Report Requirements. Unless waived in writing by the City Manager, each of the Districts’ annual reportsreport must include the following: 1. Narrative A narrative summary of the progress of the District in implementing theits Service Plan for the report year. 2. Financial Statements Except when an exemption from audit has been granted for the report year under the Local Government Audit Law, the audited financial statements of the District for the report year including a statement of financial condition (i.e., balance sheet) as of December 31 of the report year and the statement of operation (i.e., revenue and expenditures) for the report year. 3. Capital Expenditures Unless disclosed within a separate schedule to the financial statements, a summary of the capital expenditures incurred by the District in development of improvements in the report year. 4. Financial Obligations Unless disclosed within a separate schedule to the financial statements, a summary of financial obligations of the District at the end of the report year, including the amount of outstanding Debt, the amount and terms of any new District Debt issued in the report year, the total assessed valuation of all Taxable Property within the Service Area as of January 1 of the report year and the current total District mill levy pledged to Debt retirement in the report year. 5. Board Contact Information The names and contact information of the current directors on the District’s Board, any District manager and the attorney for the District shall be listed in the report. The District’s current office address, phone number, email address and any website address shall also be listed in the report. 6. Other Information Any other information deemed relevant by the City Council or deemed reasonably necessary by the City Manager. D. Reporting of Significant Events. 23 The annual report of each District shall also include information as to any of the following that occurred during the report year: 1. Boundary changes made or proposed to the District’s boundariesBoundaries as of December 31 of the report year. 2. Intergovernmental Agreements with other governmental entities, either entered into or proposed as of December 31 of the report year. 3. Copies of the District’s rules and regulations, if any, or substantial changes to the District’s rules and regulations as of December 31 of the report year. 4. A summary of any litigation which involves the District’s Public Improvements as of December 31 of the report year. 5. A list of all facilities and improvements constructed by the District that have been dedicated to and accepted by the City as of December 31 of the report year. 6. Notice of any uncured events of default by the District, which continue beyond a ninety (90) day period, under any Debt instrument. 7. Any inability of the District to pay its obligations as they come due, in accordance with the terms of such obligations, which continue beyond a ninety (90) day period. E. Failure to Submit. In the event the annual report is not timely received by the City Clerk or is not fully responsive, notice of such default shall be given to the District’s Board at its last known address. The failure of the District to file the annual report within forty-five (45) days of the mailing of such default notice by the City Clerk may constitute a material modification of thisthe Service Plan, inat the discretion of the City Manager. XVIII.XIV. SERVICE PLAN AMENDMENTS This Service Plan is general in nature and does not include specific detail in some instances. The Service Plan has been designed with sufficient flexibility to enable the Districts to provide required improvements, services and facilities under evolving circumstances without the need for numerous amendments. Modification of the general types of improvements and facilities making up the Public Improvements, and changes in proposed configurations, locations or dimensions of the Public Improvements, shall be permitted to accommodate development needs provided such Public Improvements are consistent with the then-current Approved Development Plans for the Project and any agreement approved by the City Council pursuant to the Section IV.B of this Service Plan. Any action of one or more of the Districts, which is a material modification of this Service Plan requiring a Service Plan Amendment as provided in in Section XV of this Service Plan or that does not comply with provisionsany provision of this Service Plan, shall be deemed to be a material modification to this Service Plan unless otherwise expressly provided in this Service Plan. All other departures from the provisions of this Service Plan shall be considered on 24 a case-by-case basis as to whether such departures are a material modification under this Service Plan or the Special District Act. XIX.XV. MATERIAL MODIFICATIONS Material modifications to this Service Plan may be made only in accordance with C.R.S. Section 32-1-207 as a Service Plan Amendment. No modification shall be required for an action of the Districts that does not materially depart from the provisions of this Service Plan, unless otherwise provided in this Service Plan. Departures from the Service Plan that constitute a material modification requiring a Service Plan Amendment include, without limitation: 1.A. Actions or failures to act that create materially greater financial risk or burden to the taxpayers of any of the Districts; 2.B. Performance of a service or function, construction of an improvement, or acquisition of a major facility that is not closely related to an improvement, service, function or facility authorized in the Service Plan; 3.C. Failure to perform a service or function, construct an improvement or acquire a facility required by the Service Plan; and 4.D. Failure to comply with any of the prohibitions, limitations and restrictions of this Service Plan. XX.XVI. DISSOLUTION Upon independent determination by the City Council that the purposes for which the Districts wereany District was created have been accomplished, the Districtssaid District shall file a petition in district court for dissolution as provided in the Special District Act. In no event shall dissolution occur until the Districts haveDistrict has provided for the payment or discharge of all of its outstanding indebtedness and other financial obligations as required pursuant to State law. In addition, if within three (3) years from the date of the City Council’s approval of this Service Plan no agreement contemplated under Section IV.B of this Service Plan has been entered into by the City with any of the Districts and/or any Developer, despite the parties conducting good faith negotiations attempting to do so, the City may opt to pursue the remedies available to it under C.R.S. Section 32-1-701(3) in order to compel the Districts to dissolve in a prompt and orderly manner. In such event: (i) the limited purposes and powers of the Districts, as authorized herein, shall automatically terminate and be expressly limited to taking only those actions that are reasonably necessary to dissolve; (ii) the Board of each of the Districts will be deemed to have agreed with the City regarding its dissolution without an election pursuant to C.R.S. §32-1- 704(3)(b); (iii) the Districts shall take no action to contest or impede the dissolution of the Districts and shall affirmatively and diligently cooperate in securing the final dissolution of the Districts, and (iv) subject to the statutory requirements of the Special District Act, the Districts shall thereupon dissolve. 25 XXI.XVII. SANCTIONS Should any of the Districts undertake any act without obtaining prior City Council approval or consent or City Manager approval or consent underas required in this Service Plan, that constitutes a material modification to this Service Plan requiring a Service Plan Amendment as provided herein or under the Special DistrictsDistrict Act, or that does not otherwise comply with the provisions of this Service Plan, the City Council may impose one (1) or more of the following sanctions, as it deems appropriate: 1.A. Exercise any applicable remedy under the Special District Act; 2.B. Withhold the issuance of any permit, authorization, acceptance or other administrative approval, or withhold any cooperation, necessary for the District’s development or construction or operation of improvements or provision of services; 3.C. Exercise any legal remedy under the terms of any intergovernmental agreement under which the District is in default; or 4.D. Exercise any other legal and equitable remedy available under the law, including seeking prohibitory and mandatory injunctive relief against the District, to ensure compliance with the provisions of the Service Plan or applicable law. XXII.XVIII. INTERGOVERNMENTAL AGREEMENT WITH CITY Each of the Districts and the City shall enter into an intergovernmental agreement, the form of which shall be in substantially the form attached hereto as Exhibit “L”I and incorporated by reference (the “IGA”). However, the City and the Districts may include such additional details, terms and conditions as they deem necessary in connection with the Project and the construction and funding of the Public Improvements and the Public Benefits. Each of the Districts’ Boards shall approve the IGA at their first board meeting, unless agreed otherwise by the City Manager. Entering into this IGA is a precondition to each of the Districts issuing any Debt or imposing any Debt Mill Levy, Operating Mill Levy or Fee for the payment of Debt under this Service Plan. In addition, failure of any of the Districts to enter into the IGA as required herein shall constitute a material modification of this Service Plan and subject the District to the sanctions in ArticleSection XVII of this Service Plan. The City and the Districts may amend the IGA from time-to-time provided such amendment is not in conflict with any provision of this Service Plan. XXIII.XIX. CONCLUSION It is submitted that this Service Plan, as required by C.R.S. Section 32-1-203(2), establishes that: 1.A. There is sufficient existing and projected need for organized service in the Service Area to be served by the Districts; 26 2.B. The existing service in the Service Area to be served by the Districts is inadequate for present and projected needs; 3.C. The Districts are capable of providing economical and sufficient service to the Service Area; and 4.D. The Service Area does have, and will have, the financial ability to discharge the proposed indebtedness on a reasonable basis. XXIV.XX. RESOLUTION OF APPROVAL The Districts agree to incorporate the City Council’s resolution approving this Service Plan, including any conditions on any such approval, into the copy of the Service Plan presented to the District Court for and in Larimer County, Colorado. A-1-1 EXHIBIT A-1 LEGAL DESCRIPTION OF DISTRICT NO. 1 BOUNDARIES A-2-1 EXHIBIT A-2 LEGAL DESCRIPTION OF DISTRICT NO. 2 BOUNDARIES A-3-1 EXHIBIT A-3 LEGAL DESCRIPTION OF DISTRICT NO. 3 BOUNDARIES B-1-1 EXHIBIT B-1 DISTRICT NO. 1 BOUNDARY MAP B-2-1 EXHIBIT B-2 DISTRICT NO. 2 BOUNDARY MAP B-3-1 EXHIBIT B-3 DISTRICT NO. 3 BOUNDARY MAP C-1 EXHIBIT C VICINITY MAP D-1 EXHIBIT D PUBLIC IMPROVEMENT COST ESTIMATES E-1 EXHIBIT E PUBLIC IMPROVEMENT MAPS F-1 EXHIBIT F FINANCIAL PLAN G-1 EXHIBIT G PUBLIC BENEFITS H-1 EXHIBIT H DISCLOSURE NOTICE I- 1 EXHIBIT I FORM OF INTERGOVERNMENTAL AGREEMENT 6RODUSDQHOVRQWKH  RIWRWDOXQLWV Northfield Metro District Proposal: Landmark Homes Service Plan proposal to create a metro district of approximately 56 acres located north of Vine Street on the west side of Lindenmeier Road/Lemay Avenue (southeast of the Lake Canal and north of the to- be designated historic Alta Vista neighborhood). The developer proposes that metro district tax benefits make it easier for the Landmark Homes to create increased public benefits in the areas of infrastructure, smart growth, affordable housing, attainable housing, and building with environmental sustainability practices. This scan assumes that development would happen regardless of the Metro District and analyzes the impact of a metro district compared to a business-as-usual development scenario. Positive x Inclusion of solar panels on 40% of homes. Solar will help power the community center. x EV chargers will be installed in all homes. Negative x None Identified Positive x 85% of the homes will be priced at attainable price levels, targeting families making 80-120% of AMI, “the missing middle”. x Pricing structure will reduce costs of living in the community. x Additional housing at this level may impact workforce talent attraction and retention. x May promote additional redevelopment in that corridor along Vine and accelerating connectivity through Transfort. Negative x None Identified Positive x Build out of regional trail will help promote access to nature and physical activity. x Attainability and affordable housing in proximity to jobs may promote economic mobility. x Includes 15% of units designated and restricted affordable ownership product. x Attainable price point introduces more opportunity to enter homeownership and lock in stable housing cost. Negative x None Identified Tradeoffs x Development is located near the intersection of Vine/Lemay and will likely exacerbate existing traffic challenges. x While there are obvious benefits of affordable housing to economic and social sustainability, the environmental benefits proposed are not as strong as they could be. Mitigations x The Service Plan could benefit from committing to more specific environmental public benefits (e.g. DOE Net Zero Ready homes, LEED standards) and water conservation efforts. Key Alignment: NLSH 1.1: Improve access to quality housing that is affordable to a board range of income levels; ENV 4.1: Achieve Climate Action Plan (CAP) 2020 goals and continue progress toward the 2030 goals; ECON 3.4 - Foster infill and redevelopment that enhances the community. ATTACHMENT 4 x Impacts within environmental area are neutral to positive and largely indirect because Landmark Homes’ proposal demonstrates only some benefits to these areas. Their proposal could implement additional energy and water savings initiatives. x Economic impacts are driven mostly by the development pricing, as well as it’s proximity to major employers. x The social impacts were strongest, as they were more direct and positive due to the promise of 15% affordable for-sale housing and pricing of the remaining 85% at 80-120% AMI. M EMORANDUM To: Josh Birks and Rachel Rogers Economic Health & Redevelopment, City of Fort Collins From: Dan Guimond and Elliot Kilham Economic & Planning Systems Subject: Northfield Metro District Market and Financial Review EPS #193074 Date: July 2, 2019 This memorandum summarizes Economic & Planning System’s (EPS) evaluation of the Financial Plan section of the Consolidated Service Plan (Service Plan) for the Northfield Metropolitan Service District (District). The City is required to approve the Service Plan for a Title 32 Metropolitan District prior to it being submitted for a vote by the electorate of the district. EPS’s third- party evaluation includes a review of the market and financial assumptions underlying the application as well as the feasibility of the District’s Financial Plan, including public revenue and bond proceed forecasts. The evaluation also reviews the proposal against the City’s metro district public benefit policy requirements. Development Program Northfield is a proposed 56.3-acre mixed-use community in North Fort Collins located west of North Lemay Avenue, southeast of the Lake Canal and north of East Vine Drive and the Alta Vista neighborhood, as shown in Figure 1. The District is proposed to be primarily a residential project with 442 housing units and approximately 2,700 square feet of commercial space. The residential component incorporates both for-sale and rental product, and the commercial component is oriented towards community serving retail and service uses. The project is estimated to be completed over the next six years. ATTACHMENT 5 Economic & Planning Systems Page | 2 Figure 1. Northfield Metro District Vicinity Map Diagram N W E S PROPOSED NORTHFIELD METRO DISTRICT 500 0 SCALE: 1" = 1000' 1000 Northfield Metro District Market and Financial Review Page | 3 The Developer provided a preliminary development program to D.A. Davidson, the District’s bond underwriter, as shown in Table 1. This preliminary program includes: x 40 stacked condos with a projected market value of $306,714. x 180 flats with a projected market value of $359,040. x 139 brownstones with a projected market value of $388,518. x 16 condominiums with a projected market value of $316,200. x 65 deed-restricted affordable condominiums with a projected market value of $265,200. x 2 studio apartments (for rent) with a projected market value of $200,000. x 2,679 square feet of commercial space with a projected market value of $225 per square foot. The District proposal suggests targeted uses for the commercial space include a daycare center, coffee shop, bike repair shop, or another community serving venture. Table 1. Proposed Northfield Development Program and Market Values Description Amount % Total Market Value Base $ ('20) Residential For-Sale Units $/Unit Stacked Condos 40 9% $306,714 Flats 180 41% $359,040 Brownstones 139 31% $388,518 Condominiums 16 4% $316,200 Affordable Condo (Deed-Restricted) 65 15% $265,200 Subtotal/Weighted Avg. 440 99.5% $348,175 Rental Units $/Unit MU - Studio Apts 2 0.5% $200,000 Subtotal/Weighted Avg. 2 0.5% $200,000 Total/Weighted Avg. 442 100% $347,504 Commercial Sq. Ft. $/Sq. Ft. Retail/Commercial 2,679 100% $225 Total/Weighted Avg. 2,679 100% $225 Source: DA Davidson; Economic & Planning Systems Economic & Planning Systems Page | 4 The proposed buildout of the Northfield development is estimated to take place over a six-year period from 2020 to 2025, as shown in Table 2. In total, the Developer proposes to build an average of 74 residential units per year from 2020 to 2025. The proposed commercial development is projected to occur in 2022 as shown. The project is shown with the initial development focused on 34 residences in 2020 (12 stacked condominiums, 8 brownstones, 4 condominiums, and 10 deed restricted condominiums). The remaining 408 units, including the 2 for-rent studio apartments, are expected to be built the following five years (2021 to 2025). The last phase of the project is the final flats and brownstones built in 2023 to 2025. It is important to note that this preliminary program is used as inputs into D.A. Davidson’s estimate of bond proceeds and draft bond series offerings. As the basis for the Financial Plan, EPS focused its market assessment on these inputs. Table 2. Proposed Northfield Absorption Schedule Residential (Units) Apt. Stacked Brown- Condo- Affordable Commercial Description Studio Condos Flats stone miniums Condo [2] Total (Sq. Ft.) Year 2019 0 0 0 0 0 0 0 0 2020 0 12 0 8 4 10 34 0 2021 0 28 36 42 8 31 145 0 2022 2 0 45 40 4 24 115 2,679 2023 0 0 48 40 0 0 88 0 2024 0 0 45 9 0 0 54 0 2025 0 0 6 0 0 0 6 0 Summary Total 2 40 180 139 16 65 442 2,679 Average [1] 0 7 30 23 3 11 74 447 [1] Average betw een 2020 to 2025. [2] Deed-restricted affordable condo. Source: DA Davidson; Economic & Planning Systems Northfield Metro District Market and Financial Review Page | 5 Metro District Proposal Summary The Service Plan proposes to form three separate metro districts. The districts will have the ability to impose an aggregate mill levy of 50 mills, which includes a Debt Mill Levy and an Operating Mill Levy. The operating mill levy can equal up to 50 mills until the District imposes a debt mill levy, at which point the operating mill levy cannot exceed 10 mills. While District levies are capped at 50 mills, the Service Plan allows for adjustments to the mill levies in the event that there are changes to the method of calculating assessed value or any other changes impacting the revenue generating capabilities of the District. In such cases, the District may increase or decrease mill levies to ensure that actual tax revenues generated are not diminished. This ability helps to further guarantee future revenue streams and reduce the risk for bond holders. The debt mill levy is expected to be used to finance public improvements listed in Exhibit D of the Service Plan. The financial projections are based on a debt mill levy of 40 mills for residential and commercial districts. In total, according to the Service Plan, the Developer anticipates issuing approximately $16 million in debt to fund a portion of these public improvement costs. The Developer’s engineering consultant estimates that the total cost of the public improvements will be approximately $31 million. Metro District Policy In August 2018, the City updated its policy originally adopted in 2008 for reviewing proposed metro district service plans. The new policy removes previous limitations for metro district to be 90 percent commercial and not to be used to fund “basic infrastructure improvements normally required from new development.” In their place, the policy requires that developers deliver “extraordinary public benefits” to the city. In addition, the new policy increased the recommended maximum mill levy for both debt service and O&M to 50 mills—up from 40 mills in the 2008 resolution. The proposed Northfield maximum aggregate mill levy of 50 mills is in-line with this recommended maximum mill levy. The Public Benefits section of this memo provides more detailed information on the proposed public benefits provided by the development. Economic & Planning Systems Page | 6 Market Assessment This section reviews market values and buildout/absorption assumptions used to estimate the potential public financing revenues and debt capacity of the project, as described in the proposed Financial Plan. The section is organized into the residential and commercial land uses. The residential section further delineates between for-sale and rental product, while the commercial section outlines proposed retail uses. Residential To help determine their reasonableness, EPS compared the market value assumptions used in the Financial Plan’s debt capacity estimates with recent sales in Fort Collins. In addition, EPS compared Northfield’s proposed market values with other comparable developments in the Fort Collins area. For-Sale Market Values The Developer’s proposed market values fall near the average of recent sales in the Fort Collins market. The Fort Collins Board of Realtors (FCBR) reports that the average price of a single family home sold in Fort Collins through May 2019 was $467,303 and that the average price of a townhome/condominium was $308,640, as shown in Table 3. The Northfield proposal does not include single family housing. As a result, proposed market values are compared to the average price of townhomes/condos in the Fort Collins market. x Stacked Condos: The Financial Plan uses a market value of $306,714 or 0.6 percent less than the average of recent sales. As a result, the proposed values are in line with market averages. x Flats: The Financial Plan uses a market value of $359,040 or 16.3 percent higher than the average of recent sales. The market average sales price includes both new construction sales and sales of older, existing homes. A premium for new construction in Northfield is to be expected. Moreover, the recent average sales price includes condo sales, which may bring down the average when looking at a flat, which is closer to a townhome. While perhaps higher than average, in EPS’s professional experience, the market values are within an acceptable range. In particular, a market value higher than the average of recent sales for townhomes but lower than the average for single family homes is reasonable. x Brownstones: The Financial Plan uses a market value of $388,518 or 25.9 percent higher than the average of recent sales. Brownstones are typically categorized as townhomes, however they offer features more similar to single family homes. Similar to flats, a market value higher than the average of recent sales for townhomes but lower than the average for single family homes is reasonable. x Condominiums: The Financial Plan uses a market value of $316,200 or 2.4 percent higher than the average of recent townhome/condo sales. As a result, the proposed values are in line with market averages. Northfield Metro District Market and Financial Review Page | 7 x Deed-Restricted Condos: The Financial Plan uses a market value of $265,200 or 14.1 percent less than the average of recent sales. As a result, the proposed values are in line with market averages. Table 3. Proposed Northfield Market Values Compared to Fort Collins Average Prices This section also compares Northfield to other recent for-sale residential projects in the North Fort Collins market area. This comparison reveals that Northfield’s price points for townhomes and condos largely overlap with the price ranges proposed in recent residential projects, as shown Table 4 and Figure 2. Table 4. For-Sale Residential Projects in the North Fort Collins Market Description Stacked Condos Flats Brownstones Condominiums Deed-Restricted $306,714 $359,040 $388,518 $316,200 $265,200 $308,640 $308,640 $308,640 $308,640 $308,640 Difference -$1,926 $50,400 $79,878 $7,560 -$43,440 % Difference -0.6% 16.3% 25.9% 2.4% -14.1% Source: DA Davidson; FCBR; CoStar; Economic & Planning Systems Average Price (May 2019 YTD) Service Plan (Base $ '20) Project Status Project Start Product Units Price Compable Projects Single Family $350,000-$1,300,000 Townhomes $450,000-$550,000 Condos $150,000-$450,000 Single Family 18 $575,000-$600,000 Townhomes 37 $460,000-$500,000 Single Family 567 $400,000-$530,000 Townhomes 110 $330,000-$430,000 Condos 192 $330,000-$400,000 Brownes on Howes Complete 2016 Townhomes 6 $750,000-$1,000,000 Single Family -- Townhomes -- Condos -- Townhomes at Library Park Complete 2017 Townhomes 10 $1,195,000-$1,500,000 The Park at Fossil Ridge Complete 2017 Townhomes 23 $356,000-$415,000 Northfield Condos $265,000-$316,000 Townhomes $350,000-$390,000 [1] Total housing units for all product types. Source: Zillow; CoStar; FCBR; DA Davidson; Economic & Planning Systems Service Plan Proposed 2020 442 [1] Montava Planning Review-Round 4 2020 4,200 [1] Old Town North Third Phase 2007 450-500 [1] Revive Under Construction 2015 Mosaic (formerly Eastridge) Under Construction 2016 Economic & Planning Systems Page | 8 Figure 2. Price Range in Comparable Residential Projects and Northfield Rental Housing Market Values The Northfield Financial Plan assumes that the average value for apartments in the development will have a market value of $200,000 per unit. To benchmark this assumption, EPS compared it to the historical five-year average sales price per unit of apartments in Fort Collins and to the capitalized value of apartments. Capitalized value was calculated by dividing the five-year average rent by the five-year average capitalization rate in the Fort Collins market. As shown in Table 5, the five-year average sales price was approximately $179,000 per unit or 11 percent less that the market value assumption, and the capitalization value was approximately $301,000 or 51 percent more than the market value assumption. As a result of these comparisons, EPS concludes that the market value used in the Financial Plan falls within an acceptable range and is appropriate. Table 5. Market Rate Apartment Market Value Comparison $0 $200,000 $400,000 $600,000 $800,000 $1,000,000 $1,200,000 $1,400,000 $1,600,000 Old Town North Mosaic (formerly Eastridge) Brownes on Howes Townhomes at Library Park Northfield Price Range NorthfieldAverage Sales Price Capitalized Northfield Description Per Unit [1] Value [2] Assumption Apartment Market Value ($/Sq. Ft.) $178,844 $301,154 $200,000 % Difference [3] 11% -51% 0% [1] 5-year average sales price per unit. [3] Percent difference from the market value assumption. Source: CoStar; Economic & Planning Systems [2] Capitalized value equals the 5-year average rent divided by the 5-year average capitalization rate. Northfield Metro District Market and Financial Review Page | 9 Absorption EPS compared the planned buildout to forecast future demand for specific housing products. We calculated future housing demand as part of our work on the update to Fort Collins City Plan, organizing these estimates into low density (single family homes), middle density (2- to 20-unit buildings), and high density (20 or more unit buildings) housing products. More detail on EPS’s housing demand estimate is shown in Table 8 on the following page. Based on this comparison, EPS calculated an implied capture rate by Northfield to gain a perspective on the size and reasonableness of the proposed building plan. From 2016 to 2040, EPS estimates that there will be a demand of 570 low density units, 254 middle density units, and 446 high density units per year, for a total annual average of 1,270 units. In comparison, the Developer proposes to develop the Northfield project at an average of 74 middle density units (multifamily and townhomes) per year from 2020 to 2025. This development schedule implies a capture rate of approximately 30 percent for middle density units. A capture rate of 30 percent is a significant portion of the residential development market in the Fort Collins market. However, the fact that the development is targeting the middle of the market in terms of prices and has a variety of housing types should help it attract a wider market demand segment. Implied Affordability of Deed Restricted Condo To understand the affordability benefits offered by the proposed deed restrict condos, EPS calculated the household income needed to afford the market value of the unit, assuming 30 percent of this income is dedicated to housing, as shown in Table 6. EPS calculated an income of approximately $49,000 was needed. To put this in perspective, this is under 60 percent of the area median income (AMI) for a family of four in Larimer County and approximately equal to 70 percent of the AMI for a family of two. Table 6. Household Income Implied by Deed Restricted Unit Description Units Amount Market Value $ $265,200 Mortgage Payment Term years 30 Down Payment % 10.00% Interest Rate % 4.50% Mortgage Payment $/year $14,653 Income Calculation Housing Costs % Income 30% HH Income $/year $48,843 Source: DA Davidson; Economic & Planning Systems Economic & Planning Systems Page | 10 Ultimately, Northfield’s ability to meet this implied capture rate will depend on the size of the pipeline and its competitive position against other projects. There are currently a number of proposed large-scale residential developments in North Fort Collins, including Mulberry, Waterfield, Water’s Edge, and Montava that will compete with Northfield. However, North Fort Collins is one of the few remaining growth areas of the city, meaning it may have less competition from other areas of the city. The Fort Collins market is also a very attractive area that competes regionally and even nationally. Finally, in the past, growth may have been constrained by supply. Table 7. Northfield Development Implied Residential Capture Rate Table 8. Fort Collins City Plan Future Housing Demand Estimates, 2016-2040 Northfield Fort Collins Implied Description Average Annual Avg [2] Capture % [3] 2016-2040 Middle Density [1] 74 254 29% Subtotal 74 254 29% [2] Annual average from CityPlan housing demand forecast completed by EPS. [3] Capture % = Northfield Average / Fort Collins Average. Source: Economic & Planning Systems [1] Based on definitions from the CityPlan estimate, middle density includes tow nhomes and multifamily homes. Description Amount % Total Amount % Total Total Ann. # Ann. % Low Density 42,254 66% 55,926 59% 13,672 570 1.2% Middle Density 14,891 23% 20,998 22% 6,108 254 1.4% High Density 6,590 10% 17,296 18% 10,706 446 4.1% Total 63,735 100% 94,220 100% 30,485 1,270 1.6% Source: Economic & Planning Systems 2016 2040 2016-2040 Northfield Metro District Market and Financial Review Page | 11 Commercial Development The Northfield Financial Plan assumes that the commercial space in the development will have an average value of $225 per square foot. To benchmark this assumption, EPS compared it to the historical five-year average sales price per square foot of retail space in the Fort Collins market and to the capitalized value of retail and office space. Capitalized value was calculated by dividing the five-year average rent per square foot by the five-year average capitalization rate for the respective product types, as shown in Table 9. The five-year average sales price was $200 per square foot or 11 percent less than the market value assumption used in the Financial Plan, and the capitalized value was approximately $255 per square foot or 13 percent higher than the market value. As a result of these comparisons, EPS concludes that the market value used in the Financial Plan is relatively moderate and generally within a range set by the sales price and capitalized value benchmarks. Table 9. Retail Market Value Comparison Absorption Northfield proposes to build a total of 2,680 square feet of community serving retail. EPS finds that this is a reasonable amount of retail for a development of this size. To help provide context, EPS benchmarked Northfield’s proposed retail development against historic retail development in the city to calculate an implied capture rate, as shown in Table 10. Over the last 11 years, from 2006 to 2017, the city delivered an average 127,365 square feet of retail space per year. As a result, the Northfield proposal implies a capture rate of 2.1 percent relative to the historic annual average. Table 10. Northfield Development Implied Retail Capture Rate Sales Price Capitalized Northfield Description Per Sq. Ft. [1] Value [2] Assumption Retail Market Value ($/Sq. Ft.) $200.00 $255.07 $225.00 % Difference [3] 11% -13% 0% [1] 5-year average sales price per sq. ft. [3] Percent difference from the market value assumption. Source: CoStar; Economic & Planning Systems [2] Capitalized value equals the 5-year average rent divided by the 5-year average capitalization rate. Northfield Fort Collins Northfield Description Annual Avg Annual Avg Capture % 2019-2027 2006-2017 Retail 2,680 127,365 2.1% [1] Capture % = Northfield / Fort Collins Average. Source: City of Fort Collins; Economic & Planning Systems Economic & Planning Systems Page | 12 Metro District Competition in North Fort Collins Northfield is one of five major planned developments in North Fort Collins, all proposing metro districts (others include Mulberry, Montava, Water’s Edge, and Waterfield). At buildout (from 2018 to 2042), the four proposed districts are projected to result in 7,853 additional housing units. This is 26 percent of the estimated growth of approximately 30,500 households in Fort Collins from 2016 to 2040, as shown in Table 8. Given that North Fort Collins is one of the few remaining growth areas in the city, an expected capture rate of 26 percent is not unreasonable. However, on a year-to-year basis the four developments will compete for absorption. If the developments happen to each deliver a large number of units at the same time, it may take months or even years for these units to be absorbed. This will in turn impact the bond revenue projections of the four districts. Figure 4 below compares the combined estimated residential buildout of each of the districts with the total average annual growth rate for the city in Table 8. The figure illustrates that while from 2019 to 2042 the four districts will need to capture 24 percent of total growth, in certain years the buildout schedules imply a much higher capture rate, including 107 percent in 2021. Figure 3. Implied Capture Rate Four Metro Districts 7% 40% 107% 58% 50% 39% 73% 40% 25% 28% 20% 20% 10% 11% 20% 19% 9% 9% 8% 9% 6% 0% 6% 6% 0% 20% 40% 60% 80% 100% 120% 2019 2020 2021 2022 2023 2024 2025 2026 2027 2028 2029 2030 2031 2032 2033 2034 2035 2036 2037 Northfield Metro District Market and Financial Review Page | 13 Financial Analysis The Service Plan proposes to issue metro district revenue bonds to pay for eligible public improvements. This section reviews proposed public improvement costs and the revenue and debt estimates described in the metro district Service Plan. Public Improvement Costs The Developer provided the preliminary public improvement cost estimates in Exhibit D of the Service Plan. Overall, public improvements associated with the development are estimated to be approximately $31 million, as shown in Table 11. The Developer grouped the improvements into two categories, $21 million in “Basic” infrastructure costs and $10 million in “Non-basic” costs. xx Basic: The Developer included the following items in the estimate of Basic public improvements: grading, roadway, potable waterline, sanitary sewer, and storm drainage improvements; open space, parks, and trails; and administrative/design/ permitting, and contingency costs. The Basic improvements generally include in-tract improvements that are normal costs of development. x Non-basic: The Developer included the following items in its Non-basic infrastructure: arterial upsizing and private drive construction, sanitary sewer upsizing, park and other amenities including a community pool and clubhouse. The Non-basic improvements include some off-site improvements such as arterial and sewer upsizing. Some of these costs categorized as Non-basic should not necessarily be categorized as public improvements. For example, the non-basic infrastructure includes $2 million for a community pool and clubhouse. It is unclear from the Service Plan how this will be open to and serve the public and wider Fort Collins community. However, it will be an amenity to the development, and help both attract buyers and add value. As a result, it likely should not count as a public benefit. The Developer proposes to issue debt generating approximately $13 million in project proceeds, as shown in Table 11. This debt would cover approximately 41 percent of the total public improvement costs. The Developer would need to cover the remaining $18.3 million with other funds. Economic & Planning Systems Page | 14 Table 11. Public Infrastructure and Estimated Costs Description Basic % Non-Basic % Total % Total Public Improvement Costs Grading/Miscellaneous $6,697,000 32% $0 0% $6,697,000 21% Roadway Improvements $3,122,630 15% $3,278,240 31% $6,400,870 20% Potable Waterline Improvements $617,400 3% $0 0% $617,400 2% Sanitary Sewer Improvements $148,400 1% $538,220 5% $686,620 2% Sorm Drainage Improvements $1,889,100 9% $0 0% $1,889,100 6% Open Space, Parks, and Trails $1,010,000 5% $3,047,850 29% $4,057,850 13% Admin./Design/Permitting/Etc. $3,777,000 18% $1,923,000 18% $5,700,000 18% Contingency (20%) $3,452,310 17% $1,757,465 17% $5,209,775 17% Total $20,713,840 100% $10,544,775 100% $31,258,616 83% Metro District Project Funds Series 2020 $7,098,194 55% Series 2030 $5,829,489 45% Total $12,927,683 100% Source: Highland Development Services; Economic & Planning Systems Northfield Metro District Market and Financial Review Page | 15 Revenue Estimates Proposed Mill Levies and Facility Fee The proposed maximum District mill levy of 50 mills is relatively common and within the distribution of similar metro districts in Colorado. The 50 mills would be added to the existing property tax levy of 91.139 mills and increase the property tax burden. Based on information in the Financial Plan and D.A. Davidson’s bond projections, the Developer plans to charge 50 mills (40 mills as debt levy and 10 mills for operations) to the District. For the residential portion of the property, the maximum District mill levy of 50 mills would result in an average of $1,242 per year or $104 per month of additional cost to the tenant. For the commercial portion of the property, the 50 mills would result in an average of $3.26 per square feet of additional property tax cost per year, as shown. Table 12. Metro District Mill Levies Market Assessed Property Tax Description Value Value Existing District Total Residential (Units) 7.15% 91.139 mills 50.000 mills 141.139 mills Stacked Condos $306,714 $21,930 $1,999 $1,097 $3,095 Flats $359,040 $25,671 $2,340 $1,284 $3,623 Brownstones $388,518 $27,779 $2,532 $1,389 $3,921 Value Condo $316,200 $22,608 $2,060 $1,130 $3,191 Affordable Condo (Deed-Restricted) $265,200 $18,962 $1,728 $948 $2,676 MU - Studio Apts $200,000 $14,300 $1,303 $715 $2,018 Weighted Average $347,504 $24,847 $2,264 $1,242 $3,507 % Total 65% 35% 100% Commercial ($/SF) 29.00% 91.139 mills 50.000 mills 141.139 mills Retail/Commercial $225 $65 $5.95 $3.26 $9.21 % Total 65% 35% 100% Source: DA Davidson; Economic & Planning Systems Economic & Planning Systems Page | 16 Public Revenue Forecasts and Bond Proceeds D.A. Davidson estimates that the metro district will generate a total of approximately $50 million in revenues from debt mill levy collections, as shown in Table 13. The market value and absorption assumptions described in the Market Assessment section of this memorandum are the main drivers of these revenue estimates. A reduction in the proposed market values for the residential and commercial development and/or extended buildout and absorption schedule will reduce the total bond proceeds. The underwriting process and bond structure include reserve funds and capitalized interest mitigate difference between forecasted and actual values relating to market values, buildout schedule, and other variables. These public revenues will be used to issue two bond series, one in 2020 and one in 2030 to generate approximately $13 million that can be used to reimburse the Developer for infrastructure expenditures related to the public improvements. Table 13. Northfield Metro District Public Revenue and Project Funds Description Series 2020 Series 2030 Total Public Revenues Par Value $10,020,000 $14,870,000 $24,890,000 Interest $12,021,750 $13,214,800 $25,236,550 Total $22,041,750 $28,084,800 $50,126,550 Project Proceeds Par Value $10,020,000 $14,870,000 $24,890,000 Other Source of Funds [1] $0 $1,073,406 $1,073,406 Refunding Escrow Deposits [2] $0 -$9,790,000 -$9,790,000 Capitalized Interest Fund -$1,503,000 -$49,567 -$1,552,567 Debt Service Reserve Fund -$918,406 $0 -$918,406 Cost of Issuance -$300,000 -$200,000 -$500,000 Unerwriter's Discount -$200,400 -$74,350 -$274,750 Total $7,098,194 $5,829,489 $12,927,683 [1] Funds on hand and previous series reserve funds. [1] Refinancing previous series and paying off principal of the bond. Source: DA Davidson; Economic & Planning Systems Northfield Metro District Market and Financial Review Page | 17 Public Benefits The City’s policy for reviewing metro districts supports the formation of a district “where it will deliver extraordinary public benefits that align with the goals and objectives of the City.” The policy goes on to define four focus areas or types of benefits that meet this policy as follows: x Environmental Sustainability Outcomes – defined as public improvements that provide environmental benefits including reduction in greenhouse gases, water or energy conservation, community resiliency against natural disasters, renewable energy capacity, and/or other environmental outcomes. x Critical Public Infrastructure – public improvements that address significant infrastructure needs previously identified by the City. x Smart Growth Management – public improvements that facilitate design that increases development density, enhances walkability, increases the availability of transit or multimodal facilities, and/or encourages mixed use development patterns. x Strategic Priorities – public improvements that address City priorities including affordable housing, infill or redevelopment, and economic health improvements (e.g., job growth business retention, or construction of a missing economic resource). Exhibit G of the Service Plan describes the proposed public benefits of the Northfield project. The Developer is able to provide these public benefits in part due to the District bonds that reimburse the Developer for public improvement costs. More specifically, by reimbursing basic infrastructure investments typically associated with development with District bond proceeds, the Developer is able to invest more money into public benefits the City views as priorities. The Service Plan describes a number of public benefits for the project. These include creating a New Urbanist community with low-impact development features. They also include: xx Critical Public Infrastructure – including construction of Suniga Road as an arterial road and off-site sewer improvements. x Parks, Open Space, and Trails – including a community pool, regional trail delivery, and 26 acres of parks and green spaces covering approximately 46.9 percent of the entire project. x Affordable Housing – approximately 15 percent of units sold at 80 percent of the area median income (AMI) or lower. x Attainable Housing – by offering the remaining housing units between 80 percent and 120 percent of AMI. Economic & Planning Systems Page | 18 xx Environmental Sustainability – including a commitment to 14 kW of solar capacity per “Flats” building, 240V outlets in every garage (excluding the affordable homes) for electric vehicle fast-charging stations, and using an estimated 7.63 gallons of water per square foot, well below the City’s limit of 15 gallons of water per square foot. x Smart Growth Management – including enabling stretch outcomes in other categories by keeping density at 8 units per acre, despite qualifying for a density of 12 units per acre through Northfield’s classification as an “affordable housing project.” Table 14 shows the Developer’s estimates of the value for different public benefits in the four focus areas outlined by the City. Overall, the Developer estimates that the District is providing approximately $17 million of public benefits. This amount is greater than the total estimated bond proceeds of approximately $13 million. Overall, the Service Plan does not guarantee the delivery of public benefits. Public benefits will have to be vetted and guaranteed through additional approval steps for the metro district, including approval of the development plan. After reviewing the Service Plan’s description of public benefits, EPS finds that it is difficult to determine whether certain District features should be categorized as a public benefit for the wider community or if they are arguably more appropriately categorized as an amenity for future homebuyers—thus not a benefit to the public at large. This is particularly true for the benefits described below, which the Developer has listed under the Smart Growth Management category. x Clubhouse and Swimming Pool: The Developer has included $2 million in cost for the construction of a clubhouse and swimming that potentially will primarily serve residents of the development. While the Developer gestures at benefits to the wider community, the clubhouse will definitely serve as an amenity for residents and will in turn increase home values. x Reduction in Allowed Density/More Open Space: The Developer includes a reduction in density from 12 dwelling units per acre to 8 dwelling units per acre, which the Developer values at approximately $4.5 million. This reduction in density increases the amount of open space in the project. However, while the Developer plans to use some increased open space as a buffer to the Lake Canal Wetlands, much of it will be spread throughout the development. While this open space may have some environmental benefits, including benefits for stormwater drainage, it does not preserve habitat. Instead, similar to the clubhouse and swimming pool, this open space will serve as an amenity to the project, presumably increasing home values. In addition, smart growth policies are more often associated with increases in density not reductions. Finally, how the Developer determined the value of this amenity is not substantiated. Northfield Metro District Market and Financial Review Page | 19 xx Increased Landscaped Area: The Developer includes increased landscaped area with an estimated cost of approximately $720,000 as a public benefit. Again, this increased landscape area serves as an amenity to the development. It is unclear how landscaped areas would count as “a compelling public space”—an example of benefit listed in the City’s policy. Table 14. Northfield Development Public Benefit Estimates Description Category Benefit % Total Enivronmental Sustainability 13-14 kW of solar power per "Flats" building Solar Energy $448,000 2.66% 240 V outlets Electric Vehicles $375,000 2.22% EV charging stations Electric Vehicles $30,000 0.18% Subtotal $853,000 5.06% Critical Public Infrastructure On-Site Suniga Road Upsizing Major Arterial Development $1,682,640 9.98% Off-Site Suniga Road Major Arterial Development $774,800 4.59% Regional Trail Construction Pedestrian Connectivity $199,050 1.18% Off-Site Sewer Construction and Upsizing Off-Site Infrastructure $538,220 3.19% Lemay Overpass Contribution Off-Site Infrastructure $250,000 1.48% Subtotal $3,444,710 20.42% Smart Growth Management Alley-Loaded Homes Increased Density $820,800 4.87% Reduction in Allowed Density/ More Open Space Public Spaces $4,474,100 26.53% Clubhouse and Swimming Pool Public Spaces $2,000,000 11.86% Increased Landscaped Area (46.9% of site) Public Spaces $723,800 4.29% Alta Vista Buffer Area Public Spaces $125,000 0.74% Public Amenity Area Public Spaces $5,000 0.03% Subtotal $8,148,700 48.31% Strategic Priorities 14.7% (65 units) of deed-restricted affordable housing Affordable Housing $4,420,000 26.21% 85.3% (377 units) of attainably priced housing Attainable Housing N/A [1] N/A [1] Subtotal $4,420,000 26.21% TOTAL $16,866,410 100% Source: Landmark Homes; Economic & Planning Systems [1] Developer did not provide an estimate for value of attainable housing due to the variability in pricing of housing in a range betw een 80% and 120% of AMI Economic & Planning Systems Page | 20 Summary and Conclusions x Proposed Mill Levies: The proposed Northfield maximum aggregate mill levy of 50 mills is equal to the maximum allowed under the City’s current metro district policy. x Market Values: EPS generally finds that the market values used in the public revenue estimates to be reasonable. These assumptions align with market averages, given a new construction premium, and the residential market values are comparable to other recent developments in North Fort Collins. x Affordable and Attainable Housing: EPS finds that the deed-restricted affordable condos are priced at or below 80 percent of AMI. The planned market rates units are also currently priced towards the middle of the market and should be affordable for someone earning between 80 and 120 percent of the AMI—so called “attainable” housing.” However, it is important to note that only the deed-restricted affordable units have guaranteed affordability. Other units will be priced based on the market. x Residential Absorption: Overall, EPS finds that Northfield’s proposed absorption is reasonable. Housing is priced toward the middle of the market and includes a number of different housing options, which will attract a wider market demand segment. However, Northfield will need to compete with other residential developments planned for North Fort Collins, including Mulberry, Waterfield, Water’s Edge, and Montava. The fact that North Fort Collins is one of the only remaining growth areas of the city should help each of these developments achieve a significant market share. However, in aggregate, the cumulative absorption of these large developments may exceed overall market demand and result in slower absorption for one or more of the projects. x Public Benefits: As outlined in Exhibit G Public Benefits, the Service Plan proposes a number of public improvement that potentially meet the City’s proposed metro district criteria for extraordinary public benefits. The estimated value of these benefits is greater than the estimate project fund proceeds from a bond issuance. However, there are at least three public benefits for which the categorization as a public benefit is questionable and/or the value is either unsubstantiated, including Clubhouse and Swimming Pool, Reduction in Allowed Density/More Open Space, and Increased Landscaped Area. Designed for your lifestyle. Built to last. ATTACHMENT 7 Who We Are ƒ Local Home Builder, 25 Years in Northern Colorado ƒ 2014, 2016, & 2018 Northern Colorado Home Builder of the Year ƒ To Build Homes And Communities That Inspire ƒ 92% of our sales are attached homes in Northern Colorado priced from $250,000 to $450,000 Area Map :+,7(:$7(5 3$5. Future Lemay Overpass Planned Development ƒ Districts’ boundaries include approximately 56 acres ƒ Planned development to include about 442 attached homes ƒ At least 65 affordable homes ƒ 377 attainable homes ƒ Mixed-use center with light commercial ƒ Community clubhouse and swimming pool ƒ Estimated assessed valuation of Districts at full buildout: $13,334,342 Site Rendering Powers and Mill Levies Debt Details ƒ Total Debt of Districts shall not exceed: $16,000,000 Mill Levies ƒ Aggregate Maximum: 50 mills ƒ Operating Mill Levy limited to 10 mills once a District imposes a Debt Mill Levy Districts’ Powers ƒ Plan, Design, Acquire, Construct, Install, Operate, Maintain, and Finance: streets, traffic safety controls, landscaping, storm sewers, drainage, and park and recreation facilities Estimated Cost of Public Improvements ƒ $30, ƒ Any improvements not funded by the Districts remain the responsibility of the developer ƒ City not responsible for assuming costs of improvements funded by the Districts A Metro District Will Allow Northfield to Deliver The Following Public Benefits: ƒ Affordable Homes: At least 65 units (14.7%) will priced as affordable for <80% of AMI and deed-restricted ƒ Attainable Homes: The remaining 377 units will be priced in an attainable range $290,000 - $440,000 ƒ Energy Efficiency: HERS energy ratings ranging from 49-55 ƒ Solar Panels and EV charging locations ƒ Connectivity: Onsite Regional Trail will be built for the city ƒ 15-min walk to Old Town Fort Collins and many top employment hubs ƒ One of the last infill sites this close to Downtown Fort Collins ƒ Critical Public Infrastructure: Replacement and upsizing of a dilapidated offsite sewer line and construction of a major 4-lane arterial road, Suniga Road. ƒ Community Areas: A clubhouse and swimming pool as well as 26 acres of parks and open spaces (47% of site). Fort Collins Affordability Housing starts under $400,000 have dropped 45% in the past year. Northfield’s sales prices fill in the gaps. Source: Metrostudy Affordable Housing (14.7%) Northfield’s Stretch Outcome: ƒ Minimum of 65 (14.7%) deed-restricted affordable units ƒ Affordable for residents making less then 80% of AMI for a minimum of 20 years Advantages: ƒ Provide housing solutions to low-middle income families currently underserved. ƒ Northfield’s location provides walk and bike-ability to some of Fort Collins largest employment centers, entertainment, and recreation. Attainable Housing (Remaining 85.3%) Many cities consider “attainable housing” be to between 80% - 120% of HUD’s Area Median Income (AMI). Using Northfield’s expense assumptions (i.e. mortgage, taxes, and utilities), the “attainable” ranges are as follows: ,ŽƵƐĞŚŽůĚ^ŝnjĞ ƚƚĂŝŶĂďůĞWƌŝĐĞZĂŶŐĞ Ϯ ΨϮϱϬ͕ϬϬϬͲΨϯϴϱ͕ϬϬϬ ϯ ΨϮϴϱ͕ϬϬϬͲΨϰϰϬ͕ϬϬϬ ϰ ΨϯϮϬ͕ϬϬϬͲΨϰϴϱ͕ϬϬϬ Remaining 377 units (85.3%) of homes fit within the attainable price range EŽƌƚŚĨŝĞůĚĂƐĞ^ĂůĞƐWƌŝĐĞƐ ZŽǁ,ŽƵƐĞƐ ΨϯϬϱ͕ϬϬϬͲΨϯϮϱ͕ϬϬϬ ZĞƐŝĚĞŶĐĞƐ ΨϮϵϬ͕ϬϬϬͲΨϯϬϱ͕ϬϬϬ &ůĂƚƐ ΨϮϵϱ͕ϬϬϬͲΨϯϵϱ͕ϬϬϬ ƌŽǁŶƐƚŽŶĞƐ ΨϯϵϬ͕ϬϬϬͲΨϰϰϬ͕ϬϬϬ Energy Efficiency: HERS Score 45-51% more energy efficient then a standard new home 75-81% more efficient then the average resale home In working with The Green Insight, we’ve incorporated energy efficient materials/methods to achieve the following HERS ratings: Row Houses HERS Floorplan Ratings: 50-52 Residences HERS Floorplan Ratings: 50-52 HERS Floorplan Ratings: 49-52 HERS Floorplan Ratings: 53-55 Flats Brownstones Solar Panels & EV Charging ƒ Solar panels will be installed on all the 12-unit condos and the clubhouse supplying 13-14 kilowatts of power. ƒ Electrical vehicle 250V wiring and outlets will be provided in every garage. ƒ EV dual-port charging stations will be available for residents and guests in parking throughout the project Connectivity Trails: ƒ Landmark will construct the onsite regional trail along western edge of the project connecting: ƒ Southwest to Downtown Fort Collins (15 min walk) ƒ Northeast to Lemay & Conifer (5 min walk) ƒ Bike/Ped Connections to Alta Vista neighborhood Regional Roads: ƒ Suniga Road, a major 4-lane arterial road, bisects the project ƒ Northfield looses a considerable amount of developable space when compared to a typical 2-lane Connector Local Street. 6XQLJD5RDG Proximity to Employment ƒ 15-minute walk to Old Town Square ƒ Walk/Bike to many of the top employment centers in Fort Collins (employee counts shown on map) Sewer Upsizing ƒ 2,694 feet of off-site dilapidated sewer needs to be replaced from Vine Dr (see red line) ƒ Northfield will replace and upsize the sewer as well as finance it until the city is able to reimburse per the city’s reimbursement policy ƒ Fixes a critical and nearly failing piece of public infrastructure Remaining Metro District Enabled Benefits Community Areas: ƒ Clubhouse with swimming pool, kitchen, fitness center, and BBQ area. ƒ Mixed-use center – Light commercial use on first floor with daycare, coffee shop, or bike repair shop as possible tenants ƒ Public Amenity area along regional trail – bike repair or dog wash stations are possible uses Parks/Open Spaces: ƒ 26 acres of parks and open spaces (47% of the site) ƒ NOTE: A typical Landmark project has 33% of open space ƒ Alta Vista buffer area ƒ Alley-loaded homes Fort Collins New City Plan How we meet each Core Value: Livability ƒ Creating affordable & attainable housing prices ƒ A distinct & attractive community through many different building materials & elevations Sustainability ƒ Energy efficient homes (HERS 49-55) ƒ Solar Panels on “Flats” buildings ƒ Electric vehicle charging outlets in every garage and stations located throughout Community ƒ Diverse neighborhood featuring many different price points, product types, and configurations ƒ Bringing workforce housing within walking/biking distance to employment Source: Fort Collins City Plan “Neighborhood Livability and Social Health” Clubhouse Rendering METRO DISTRICTS COMBINED VICINITY MAP Waterfield Mulberry Montava Water’s Edge Phase 1 & 2 Northfield ATTACHMENT 6  1RUWKILHOG0HWUR'LVWULFW5HTXHVW3UHYLHZ $XJXVW Josh Birks ATTACHMENT 8 3URMHFW'HVFULSWLRQ ‡ <HDU0XOWL 3KDVH0DVWHU 3ODQQHG3URMHFW ‡ 5HVLGHQWLDO 8QLWV ‡  DIIRUGDEOH  3ROLF\&RPSDULVRQ± .H\3URYLVLRQV  3URMHFW &XUUHQW3ROLF\ 0LOO/HY\&DSV 0LOOV 0LOOV %DVLF,QIUDVWUXFWXUH 3DUWLDOO\ 7RHQDEOHSXEOLFEHQHILW (PLQHQW'RPDLQ :LOO&RPSO\ 3URKLELWHG 'HEW/LPLWDWLRQ :LOO&RPSO\ RI&DSDFLW\ 'LVVROXWLRQ/LPLW 2QJRLQJIRU2 0 \HDUV HQGXVHU UHIXQGLQJH[FHSWLRQ &LWL]HQ&RQWURO :LOO&RPSO\ $VHDUO\DVSRVVLEOH 0XOWLSOH'LVWULFWV <HV 3URMHFWHGRYHUDQ H[WHQGHGSHULRG &RPPHUFLDO 5HVLGHQWLDO5DWLR 5HVLGHQWLDO 1$ 3XEOLF,PSURYHPHQWV  ,PSURYHPHQW 'HVFULSWLRQ (VWLPDWHG&RVW PLOOLRQV (DUWKZRUNDQG*UDGLQJ 3ULPDULO\JUDGLQJ  5RDGZD\,PSURYHPHQWV 5RDGV3DUNLQJ/RWV6LJQDJH/LJKWLQJ  :DWHU,PSURYHPHQWV :DWHUOLQHV  6DQLWDU\6HZHU,PSURYHPHQWV 6HZHULQIUDVWUXFWXUHLQFOXGLQJXSVL]LQJ ERWKRQ DQGRIIVLWHIRUWKHSURMHFW  6WRUP6HZHU,PSURYHPHQWV 0DLQLQIUDVWUXFWXUH  /DQGVFDSLQJ 5HJLRQDO7UDLOFRQVWUXFWLRQQHLJKERUKRRG SDUNGHYHORSPHQWGHYHORSPHQWRI FOXEKRXVHSRRODQGRWKHUODQGVFDSLQJ  0LVF$PHQLW\ (QJLQHHULQJLQVSHFWLRQDQGDGPLQLVWUDWLYH FRVWV  &RQWLQJHQF\&RVWV &RQWLQJHQF\ RIFRQVWUXFWLRQ  7RWDO  6XPLVVOLJKWO\RIIGXHWRURXQGLQJ 3ROLF\(YDOXDWLRQ 3XEOLF%HQHILWV (QYLURQPHQWDO 6XVWDLQDELOLW\ *+*5HGXFWLRQ :DWHU(QHUJ\ &RQVHUYDWLRQ 0XOWLPRGDO 7UDQVSRUWDWLRQ (QKDQFH5HVLOLHQF\ ,QFUHDVH5HQHZDEOH &DSDFLW\ &ULWLFDO3XEOLF ,QIUDVWUXFWXUH ([LVWLQJVLJQLILFDQW LQIUDVWUXFWXUH FKDOOHQJHV 2QVLWH 2IIVLWH 6PDUW*URZWK 0DQDJHPHQW ,QFUHDVHGHQVLW\ :DONDELOLW\3HGHVWULDQ ,QIUDVWUXFWXUH $YDLODELOLW\RI7UDQVLW 3XEOLF6SDFHV 0L[HG8VH 6WUDWHJLF 3ULRULWLHV $IIRUGDEOH+RXVLQJ :RUNIRUFH+RXVLQJ ,QILOO5HGHYHORSPHQW (FRQRPLF+HDOWK 2XWFRPHV  =HUR(QHUJ\5HDG\+RPH %DVHOLQH+RPH ‡ ,(&&&RGHZLWKORFDORSWLRQV 1RUWKILHOG0HWUR'LVWULFW+RPH RQO\ KRPHVDWWKHDWWDLQDEOHSULFHSRLQW $IIRUGDEOH+RXVLQJ  3HUVRQ+RXVHKROG  6RXUFH+RXVLQJ 8UEDQ'HYHORSPHQW86*RY¶W6RFLDO6XVWDLQDELOLW\ 3HUFHQW $0, $UHD0HGLDQ ,QFRPH $0, +8'&ODVVLILFDWLRQ   0RGHUDWH,QFRPH   /RZ,QFRPH   /RZ,QFRPH   9HU\/RZ,QFRPH   ([WUHPHO\/RZ,QFRPH 3ROLF\(YDOXDWLRQ 3XEOLF%HQHILWV  6RODUSDQHOVRQWKH RIWRWDOXQLWV  7ULSOH%RWWRP/LQH6FDQ 7%/6 4XHVWLRQVIRUWKH&RXQFLO ‡ :KDWDGGLWLRQDOLQIRUPDWLRQGRHVWKH&RXQFLO KDYHLQWKHHYDOXDWLRQRIWKHSURSRVHG1RUWKILHOG 0HWUR'LVWULFW6HUYLFH3ODQ"  -1- RESOLUTION 2019-092 OF THE CITY COUNCIL OF THE CITY OF FORT COLLINS APPROVING THE CONSOLIDATED SERVICE PLAN FOR NORTHFIELD METROPOLITAN DISTRICT NOS. 1-3 WHEREAS, Title 32 of the Colorado Revised Statutes (“C.R.S.”) authorizes the formation of various kinds of governmental entities to finance and operate public services and infrastructure, including metropolitan districts; and WHEREAS, in July 2008, the City Council adopted Resolution 2008-069 in which it approved a policy setting forth various guidelines, requirements and criteria concerning the City’s review and approval of service plans for metropolitan districts (the “2008 Policy”); and WHEREAS, on February 5, 2019, City Council adopted Resolution 2019-016 approving the “City of Fort Collins Revised Policy for Reviewing Service Plans for Metropolitan Districts” (the “2019 Policy”) setting forth guidelines, requirements and criteria applicable to the City’s consideration of a metropolitan district service plan to replace and supersede those in the 2008 Policy, except for the fee and notice requirements when they have been satisfied by a service plan applicant under the 2008 Policy before the adoption of the 2019 Policy; and WHEREAS, pursuant to the provisions of Article 1 of Title 32 of the Colorado Revised Statutes (the “Special District Act”), Hartford Investments, LLC (the “Petitioner”) has submitted to the City a Consolidated Service Plan (the “Service Plan”) for the Northfield Metropolitan District Nos. 1-3 (each a “District” and collectively the “Districts”); and WHEREAS, a copy of the Service Plan is attached as Exhibit “A” and incorporated herein by reference; and WHEREAS, the Districts will be organized to provide for the planning, design, acquisition, construction, installation, relocation, redevelopment and operation and maintenance of all or a portion of certain public improvements, as more specifically described in the Service Plan; and WHEREAS, in accordance with the 2019 Policy, the Petitioner has complied with the requirement for mailed notice of the City Council’s August 20, 2019 public hearing on the Service Plan (the “Public Hearing”), as evidenced by the “Certificate of Mailing of Notice of Public Hearing” attached as Exhibit “B” and incorporated herein by reference; and WHEREAS, the Petitioner has also provided notice of the Public Hearing by publication as evidenced by the “Affidavit of Publication” attached as Exhibit “C” and incorporated herein by reference; and WHEREAS, on August 20, 2019, the City Council took action which, under Section 2.c. of City Council’s Rules of Procedure (May 21, 2019), continued its consideration of the Service Plan to its September 3, 2019, regular meeting; and -2- WHEREAS, additional notice of this continued consideration was mailed on August 22, 2019, as evidenced in the “Certificate of Mailing of Public Hearing” dated August 27, 2019, attached hereto as Exhibit “D” and incorporated herein by reference, and such notice was also published in the Coloradoan on August 24, 2019; and WHEREAS, on September 3, 2019, the City Council conducted its public hearing on the Service Plan, in which it reviewed the Service Plan and considered the testimony and evidence concerning it presented at the hearing; and WHEREAS, the Special District Act requires that any service plan submitted to the district court for the creation of a metropolitan district must first be approved by resolution of the governing body of the municipality within which the proposed district lies; and WHEREAS, the City Council wishes to approve the Service Plan for the Districts. NOW, THEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF FORT COLLINS, COLORADO, as follows: Section 1. That the City Council hereby makes and adopts the determinations and findings contained in the recitals set forth above. Section 2. That the City Council hereby determines that the City’s notification requirements have been substantially complied with regarding the City Council’s public hearing on the Service Plan conducted on September 3, 2019. Section 3. That the City Council hereby finds and determines that the Service Plan contains, or sufficiently provides for, the items described in C.R.S. Section 32-1-202(2), which are: (a) A description of the Districts’ proposed services; (b) A financial plan showing how the proposed services are to be financed, including the proposed operating revenue derived from property taxes for the first budget year of the Districts; (c) All proposed indebtedness for the Districts displayed together with a schedule indicating the year or years in which the debt is scheduled to be issued; (d) A preliminary engineering or architectural survey showing how the proposed services are to be provided; (e) A map of the proposed Districts’ boundaries and an estimate of the population and valuation for assessment of the proposed Districts; (f) A general description of the facilities to be constructed and the standards of such construction, including a statement of how the facility and service standards of the proposed Districts will be compatible with the City’s facility and service standards; -3- (g) A general description of the estimated cost of acquiring land, engineering services, legal services, administrative services, initial proposed indebtedness and estimated proposed maximum interest rates and discounts, and other major expenses related to the organization and initial operation of the Districts; and (f) A description of any arrangement or proposed agreement with any political subdivision for the performance of any services between the proposed Districts and such other political subdivision, and, if the form contract to be used is available, it shall be attached to the Service Plan. Section 4. That the City Council hereby further finds and determines with respect to the Service Plan and in accordance with C.R.S. Sections 32-1-203(2) and 32-1-204.5(1), that: (a) There is sufficient existing and projected need for organized service in the area to be serviced by the proposed Districts; (b) The existing service in the area to be served by the proposed Districts is inadequate for present and projected needs; (c) The proposed Districts are capable of providing economical and sufficient service to the area within the proposed boundaries; and (d) The area to be included in the proposed Districts has, or will have, the financial ability to discharge the proposed indebtedness on a reasonable basis. Section 5. The City Council’s findings are based solely upon the evidence in the Service Plan as presented at the Public Hearing and the City has not conducted any independent investigation of the evidence. The City makes no guarantee as to the financial viability of the Districts or the achievability of the desired results. Section 6. That the City Council hereby approves the Service Plan. Section 7. That the City Council’s approval of the Service Plan is not a waiver or a limitation upon any power that the City or the City Council is legally permitted to exercise regarding the property within the Districts. -4- Passed and adopted at a regular meeting of the Council of the City of Fort Collins this 3rd day of September, A.D. 2019. _________________________________ Mayor ATTEST: _____________________________ City Clerk   CONSOLIDATED SERVICE PLAN FOR NORTHFIELD METROPOLITAN DISTRICT NOS. 1-3 CITY OF FORT COLLINS, COLORADO           3UHSDUHGE\  :+,7(%($5$1.(/(7$1$.$ :$/'521 (&RPPRQV$YH6XLWH &HQWHQQLDO&2  6XEPLWWHG2Q$XJXVW $SSURYHGRQ>BBBBBBBBBBBBBBBBBB@  L TABLE OF CONTENTS  , ,1752'8&7,21 $ 3XUSRVHDQG,QWHQW % 1HHGIRUWKH'LVWULFWV & 2EMHFWLYHRIWKH&LW\5HJDUGLQJ'LVWULFWV¶6HUYLFH3ODQ ' &LW\$SSURYDOV ,, '(),1,7,216 ,,, %281'$5,(6$1'/2&$7,21 ,9 '(6&5,37,212)352-(&73/$11(''(9(/230(1738%/,&%(1(),76  $66(66('9$/8$7,21 $ 3URMHFWDQG3ODQQHG'HYHORSPHQW % 3XEOLF%HQHILWV & $VVHVVHG9DOXDWLRQ 9 ,1&/86,212)/$1',17+(6(59,&($5($ 9, ',675,&7*29(51$1&( 9,, $87+25,=('$1'352+,%,7('32:(56 $ *HQHUDO*UDQWRI3RZHUV % 3URKLELWHG,PSURYHPHQWVDQG6HUYLFHVDQGRWKHU5HVWULFWLRQVDQG/LPLWDWLRQV  (PLQHQW'RPDLQ5HVWULFWLRQ  )HH/LPLWDWLRQ  2SHUDWLRQVDQG0DLQWHQDQFH  )LUH3URWHFWLRQ5HVWULFWLRQ  3XEOLF6DIHW\6HUYLFHV5HVWULFWLRQ  *UDQWVIURP*RYHUQPHQWDO$JHQFLHV5HVWULFWLRQ  *ROI&RXUVH&RQVWUXFWLRQ5HVWULFWLRQ  7HOHYLVLRQ5HOD\DQG7UDQVODWLRQ5HVWULFWLRQ  3RWDEOH:DWHUDQG:DVWHZDWHU7UHDWPHQW)DFLOLWLHV  6DOHVDQG8VH7D[([HPSWLRQ/LPLWDWLRQ  6XEGLVWULFW5HVWULFWLRQ  3ULYDWHO\3ODFHG'HEW/LPLWDWLRQ  6SHFLDO$VVHVVPHQWV 9,,, 38%/,&,03529(0(176$1'(67,0$7('&2676 $ 'HYHORSPHQW6WDQGDUGV % &RQWUDFWLQJ  LL & /DQG$FTXLVLWLRQDQG&RQYH\DQFH ' (TXDO(PSOR\PHQWDQG'LVFULPLQDWLRQ ,; ),1$1&,$/3/$1352326(''(%7 $ )LQDQFLDO3ODQ % 0LOO/HYLHV  $JJUHJDWH0LOO/HY\0D[LPXP  5HJLRQDO0LOO/HY\1RW,QFOXGHGLQ2WKHU0LOO/HYLHV  2SHUDWLQJ0LOO/HY\  *DOODJKHU$GMXVWPHQWV  ([FHVVLYH0LOO/HY\3OHGJHV  5HIXQGLQJ'HEW  0D[LPXP'HEW$XWKRUL]DWLRQ & 0D[LPXP9RWHG,QWHUHVW5DWHDQG8QGHUZULWLQJ'LVFRXQW ' ,QWHUHVW5DWHDQG8QGHUZULWLQJ'LVFRXQW&HUWLILFDWLRQ ( 'LVFORVXUHWR3XUFKDVHUV ) ([WHUQDO)LQDQFLDO$GYLVRU * 'LVFORVXUHWR'HEW3XUFKDVHUV + 6HFXULW\IRU'HEW , 7$%25&RPSOLDQFH - 'LVWULFWV¶2SHUDWLQJ&RVWV ; 5(*,21$/,03529(0(176 $ 5HJLRQDO0LOO/HY\$XWKRULW\ % 5HJLRQDO0LOO/HY\,PSRVLWLRQ & &LW\1RWLFH5HJDUGLQJ5HJLRQDO,PSURYHPHQWV ' 5HJLRQDO,PSURYHPHQWV$XWKRUL]HG8QGHU6HUYLFH3ODQ ( ([SHQGLWXUHRI5HJLRQDO0LO/HY\5HYHQXHV  ,QWHUJRYHUQPHQWDO$JUHHPHQW  1R,QWHUJRYHUQPHQWDO$JUHHPHQW ) 5HJLRQDO0LOO/HY\7HUP * &RPSOHWLRQRI5HJLRQDO,PSURYHPHQWV + &LW\$XWKRULW\WR5HTXLUH,PSRVLWLRQ , 5HJLRQDO0LOO/HY\1RW,QFOXGHGLQ2WKHU0LOO/HYLHV - *DOODJKHU$GMXVWPHQW ;, &,7<)((6  LLL ;,, %$1.5837&</,0,7$7,216 ;,,, $118$/5(32576$1'%2$5'0((7,1*6 $ *HQHUDO % %RDUG0HHWLQJV & 5HSRUW5HTXLUHPHQWV  1DUUDWLYH  )LQDQFLDO6WDWHPHQWV  &DSLWDO([SHQGLWXUHV  )LQDQFLDO2EOLJDWLRQV  %RDUG&RQWDFW,QIRUPDWLRQ  2WKHU,QIRUPDWLRQ ' 5HSRUWLQJRI6LJQLILFDQW(YHQWV ( )DLOXUHWR6XEPLW ;,9 6(59,&(3/$1$0(1'0(176 ;9 0$7(5,$/02',),&$7,216 ;9, ',662/87,21 ;9,, 6$1&7,216 ;9,,, ,17(5*29(510(17$/$*5((0(17:,7+&,7< ;,; &21&/86,21 ;; 5(62/87,212)$33529$/    LY  EXHIBITS  (;+,%,7$ /HJDO'HVFULSWLRQRI'LVWULFW1R%RXQGDULHV (;+,%,7$ /HJDO'HVFULSWLRQRI'LVWULFW1R%RXQGDULHV (;+,%,7$ /HJDO'HVFULSWLRQRI'LVWULFW1R%RXQGDULHV (;+,%,7% 'LVWULFW1R%RXQGDU\0DS (;+,%,7% 'LVWULFW1R%RXQGDU\0DS (;+,%,7% 'LVWULFW1R%RXQGDU\0DS (;+,%,7&  9LFLQLW\0DS (;+,%,7'  3XEOLF,PSURYHPHQW&RVW(VWLPDWHV (;+,%,7(  3XEOLF,PSURYHPHQW0DSV (;+,%,7)  )LQDQFLDO3ODQ (;+,%,7*  3XEOLF%HQHILWV (;+,%,7+  'LVFORVXUH1RWLFH (;+,%,7,  )RUPRI,QWHUJRYHUQPHQWDO$JUHHPHQW  I. INTRODUCTION A. Purpose and Intent. 7KH 'LVWULFWV ZKLFK DUH LQWHQGHG WR EH LQGHSHQGHQW XQLWV RI ORFDO JRYHUQPHQW VHSDUDWHDQGGLVWLQFWIURPWKH&LW\DUHJRYHUQHGE\WKLV6HUYLFH3ODQWKH6SHFLDO'LVWULFW$FWDQG RWKHUDSSOLFDEOH6WDWHODZ([FHSWDVPD\RWKHUZLVHEHSURYLGHGE\6WDWHODZ&LW\&RGHRUWKLV 6HUYLFH3ODQWKH'LVWULFWV¶DFWLYLWLHVDUHVXEMHFWWRUHYLHZDQGDSSURYDOE\WKH&LW\&RXQFLORQO\ LQVRIDUDVWKH\DUHDPDWHULDOPRGLILFDWLRQRIWKLV6HUYLFH3ODQXQGHU&566HFWLRQRI WKH6SHFLDO'LVWULFW$FW ,WLVLQWHQGHGWKDWWKH'LVWULFWVZLOOSURYLGHDOORUSDUWRIWKH3XEOLF,PSURYHPHQWV IRUWKH3URMHFWIRUWKHXVHDQGEHQHILWRIDOODQWLFLSDWHGLQKDELWDQWVDQGWD[SD\HUVRIWKH'LVWULFWV 7KH SULPDU\ SXUSRVH RI WKH 'LVWULFWV ZLOO EH WR ILQDQFH WKH FRQVWUXFWLRQ RI WKHVH 3XEOLF ,PSURYHPHQWVE\WKHLVVXDQFHRI'HEW ,WLVDOVRLQWHQGHGXQGHUWKLV6HUYLFH3ODQWKDWQR'LVWULFWVKDOOEHDXWKRUL]HGWR LVVXHDQ\'HEWLPSRVHD'HEW0LOO/HY\RULPSRVHDQ\)HHVIRUSD\PHQWRQ'HEWXQOHVVDQG XQWLOWKHGHOLYHU\RIWKHDSSOLFDEOH3XEOLF%HQHILWVGHVFULEHGLQ6HFWLRQ,9%RIWKLV6HUYLFH3ODQ KDVEHHQVHFXUHGLQDFFRUGDQFHZLWK6HFWLRQ,9%RIWKLV6HUYLFH3ODQ ,WLVLQWHQGHGWKDWWKLV6HUYLFH3ODQDOVRUHTXLUHVWKH'LVWULFWVWRSD\DSRUWLRQRIWKH FRVW RI WKH5HJLRQDO,PSURYHPHQWV DV SURYLGHG LQ 6HFWLRQ; RI WKLV 6HUYLFH 3ODQ DV SDUW RI HQVXULQJWKDWWKRVHSULYDWHO\RZQHGSURSHUWLHVWREHGHYHORSHGLQWKH'LVWULFWVWKDWEHQHILWIURP WKH5HJLRQDO,PSURYHPHQWVSD\DUHDVRQDEOHVKDUHRIWKHDVVRFLDWHGFRVWV 7KH 'LVWULFWV DUH QRW LQWHQGHG WR SURYLGH RQJRLQJ RSHUDWLRQV DQG PDLQWHQDQFH VHUYLFHVH[FHSWDVH[SUHVVO\DXWKRUL]HGLQWKLV6HUYLFH3ODQ ,WLVWKHLQWHQWRIWKH'LVWULFWVWRGLVVROYHXSRQSD\PHQWRUGHIHDVDQFHRIDOO'HEW LQFXUUHGRUXSRQDFRXUWGHWHUPLQDWLRQWKDWDGHTXDWHSURYLVLRQKDVEHHQPDGHIRUWKHSD\PHQWRI DOO'HEWH[FHSW WKDW LI WKH'LVWULFWVDUHDXWKRUL]HG LQ WKLV6HUYLFH3ODQWRSHUIRUPFRQWLQXLQJ RSHUDWLQJRUPDLQWHQDQFHIXQFWLRQVWKH'LVWULFWVVKDOOFRQWLQXHLQH[LVWHQFHIRUWKHVROHSXUSRVH RISURYLGLQJVXFKIXQFWLRQVDQGVKDOOUHWDLQRQO\WKHSRZHUVQHFHVVDU\WRLPSRVHDQGFROOHFWWKH WD[HVRU)HHVDXWKRUL]HGLQWKLV6HUYLFH3ODQWRSD\IRUWKHFRVWVRIWKRVHIXQFWLRQV ,WLVLQWHQGHGWKDWWKH'LVWULFWVVKDOOFRPSO\ZLWKWKHSURYLVLRQVRIWKLV6HUYLFH3ODQ DQGWKDWWKH&LW\PD\HQIRUFHDQ\QRQFRPSOLDQFHZLWKWKHVHSURYLVLRQVDVSURYLGHGLQ6HFWLRQV ;9,,DQG;9,,,RIWKLV6HUYLFH3ODQ B. Need for the Districts. 7KHUHDUHFXUUHQWO\QRRWKHUJRYHUQPHQWDOHQWLWLHVLQFOXGLQJWKH&LW\ORFDWHGLQ WKHLPPHGLDWHYLFLQLW\RIWKH'LVWULFWVWKDWFRQVLGHULWGHVLUDEOHIHDVLEOHRUSUDFWLFDOWRXQGHUWDNH WKH SODQQLQJ GHVLJQ DFTXLVLWLRQ FRQVWUXFWLRQ LQVWDOODWLRQ UHORFDWLRQ UHGHYHORSPHQW DQG ILQDQFLQJ RI WKH 3XEOLF ,PSURYHPHQWVQHHGHGIRUWKH3URMHFW)RUPDWLRQ RI WKH 'LVWULFWV LV WKHUHIRUHQHFHVVDU\LQRUGHUIRUWKH3XEOLF,PSURYHPHQWVUHTXLUHGIRUWKH3URMHFWWREHSURYLGHG LQWKHPRVWHFRQRPLFPDQQHUSRVVLEOH  C. Objective of the City Regarding Districts’ Service Plan. 7KH&LW\¶VREMHFWLYHLQDSSURYLQJWKLV6HUYLFH3ODQLVWRDXWKRUL]HWKH'LVWULFWVWR SURYLGH IRU WKH SODQQLQJ GHVLJQ DFTXLVLWLRQ FRQVWUXFWLRQ LQVWDOODWLRQ UHORFDWLRQ DQG UHGHYHORSPHQWRIWKH3XEOLF,PSURYHPHQWVIURPWKHSURFHHGVRI'HEWWREHLVVXHGE\WKH'LVWULFWV EXW LQ GRLQJ VR WR DOVR HVWDEOLVK LQ WKH 6HUYLFH 3ODQ WKH PHDQV E\ ZKLFK WKH 5HJLRQDO ,PSURYHPHQWV DQG 3XEOLF %HQHILWV ZLOO EH SURYLGHG  ([FHSW DV VSHFLILFDOO\ SURYLGHG LQ WKLV 6HUYLFH3ODQDOO'HEWLVH[SHFWHGWREHUHSDLGE\WD[HVDQG)HHVLPSRVHGDQGFROOHFWHGIRUQR ORQJHUWKDQWKH0D[LPXP'HEW0LOO/HY\,PSRVLWLRQ7HUPIRUUHVLGHQWLDOSURSHUWLHVDQGDWDWD[ PLOOOHY\QRKLJKHUWKDQWKH0D[LPXP'HEW0LOO/HY\)HHVLPSRVHGIRUWKHSD\PHQWRI'HEW VKDOOEHGXHQRODWHUWKDQXSRQWKHLVVXDQFHRIDEXLOGLQJSHUPLW'HEWZKLFKLVLVVXHGZLWKLQWKHVH SDUDPHWHUV DQG DV IXUWKHUGHVFULEHGLQWKH)LQDQFLDO3ODQZLOOLQVXODWHSURSHUW\RZQHUVIURP H[FHVVLYHWD[DQG)HHEXUGHQVWRVXSSRUWWKHVHUYLFLQJRIWKH'HEWDQGZLOOUHVXOWLQDWLPHO\DQG UHDVRQDEOHGLVFKDUJHRIWKH'HEW D. City Approvals. $Q\SURYLVLRQLQWKLV6HUYLFH3ODQUHTXLULQJ³City´RU³City Council´DSSURYDORU FRQVHQWVKDOOUHTXLUHWKH&LW\&RXQFLO¶VSULRUZULWWHQDSSURYDORUFRQVHQWH[HUFLVHG LQ LWVVROH GLVFUHWLRQ$Q\SURYLVLRQLQWKLV6HUYLFH3ODQUHTXLULQJ³City Manager´DSSURYDORUFRQVHQWVKDOO UHTXLUHWKH&LW\0DQDJHU¶VSULRUZULWWHQDSSURYDORUFRQVHQWH[HUFLVHGLQWKH&LW\0DQDJHU¶VVROH GLVFUHWLRQ II. DEFINITIONS ,QWKLV6HUYLFH3ODQWKHIROORZLQJZRUGVWHUPVDQGSKUDVHVZKLFKDSSHDULQDFDSLWDOL]HG IRUPDWVKDOOKDYHWKHPHDQLQJLQGLFDWHGEHORZXQOHVVWKHFRQWH[WFOHDUO\UHTXLUHVRWKHUZLVH Aggregate Mill LevyPHDQVWKHWRWDOPLOOOHY\UHVXOWLQJIURPDGGLQJD'LVWULFW¶V'HEW 0LOO/HY\ DQG2SHUDWLQJ0LOO/HY\  $'LVWULFW¶V$JJUHJDWH0LOO/HY\ GRHV QRW LQFOXGH DQ\ 5HJLRQDO0LOO/HY\WKDWWKH'LVWULFWPD\OHY\ Aggregate Mill Levy MaximumPHDQVWKHPD[LPXPQXPEHURIFRPELQHGPLOOVWKH 'LVWULFWVPD\HDFKOHY\IRULWV'HEW0LOO/HY\DQG2SHUDWLQJ0LOO/HY\DWDUDWHQRWWRH[FHHGWKH OLPLWDWLRQVHWLQ6HFWLRQ,;% Approved Development PlanPHDQVD&LW\DSSURYHGGHYHORSPHQWSODQRURWKHUODQG XVH DSSOLFDWLRQ UHTXLUHG E\ WKH &LW\ &RGH IRU LGHQWLI\LQJ DPRQJ RWKHU WKLQJV SXEOLF LPSURYHPHQWV QHFHVVDU\ IRU IDFLOLWDWLQJ WKH GHYHORSPHQW RI SURSHUW\ ZLWKLQ WKH 6HUYLFH$UHD ZKLFKSODQVKDOOLQFOXGHZLWKRXWOLPLWDWLRQDQ\GHYHORSPHQWDJUHHPHQWUHTXLUHGE\ WKH&LW\ &RGH Board or BoardsPHDQVWKHGXO\FRQVWLWXWHGERDUGRIGLUHFWRUVRIHDFKRIWKH'LVWULFWV RUWKH%RDUGVRI'LUHFWRUVRIDOORIWKH'LVWULFWVLQWKHDJJUHJDWH Bond, Bonds or Debt PHDQV ERQGV QRWHV RU RWKHU PXOWLSOH ILVFDO \HDU ILQDQFLDO REOLJDWLRQVIRUWKHSD\PHQWRIZKLFKD'LVWULFWKDVSURPLVHGWRLPSRVHDQDGYDORUHPSURSHUW\WD[  PLOOOHY\)HHVRURWKHUOHJDOO\DYDLODEOHUHYHQXH6XFKWHUPVGRQRWLQFOXGHFRQWUDFWVWKURXJK ZKLFKD'LVWULFWSURFXUHVRUSURYLGHVVHUYLFHVRUWDQJLEOHSURSHUW\ CityPHDQVWKH&LW\RI)RUW&ROOLQV&RORUDGRDKRPHUXOHPXQLFLSDOLW\ City CodePHDQVFROOHFWLYHO\WKH&LW\¶V0XQLFLSDO&KDUWHU0XQLFLSDO&RGH/DQG8VH &RGHDQGRUGLQDQFHVDVDOODUHQRZH[LVWLQJDQGKHUHDIWHUDPHQGHG City CouncilPHDQVWKH&LW\&RXQFLORIWKH&LW\ City ManagerPHDQVWKH&LW\0DQDJHURIWKH&LW\ C.R.S.PHDQVWKH&RORUDGR5HYLVHG6WDWXWHV Debt Mill LevyPHDQVDSURSHUW\WD[PLOOOHY\LPSRVHGRQ7D[DEOH3URSHUW\ZLWKLQD 'LVWULFWIRUWKHSXUSRVHRISD\LQJ'HEWDVDXWKRUL]HGLQWKLV6HUYLFH3ODQDWDUDWHQRWWRH[FHHG WKHOLPLWDWLRQVVHWLQ6HFWLRQ,;%RIWKLV6HUYLFH3ODQ DeveloperPHDQVDSHUVRQRUHQWLW\WKDWLVWKHRZQHURISURSHUW\RURZQHURIFRQWUDFWXDO ULJKWVWRSURSHUW\LQWKH6HUYLFH$UHDWKDWLQWHQGVWRGHYHORSWKHSURSHUW\ District PHDQV DQ\ RI WKH IROORZLQJ PHWURSROLWDQ GLVWULFWV 1RUWKILHOG 0HWURSROLWDQ 'LVWULFW1R1RUWKILHOG0HWURSROLWDQ'LVWULFW1RDQG1RUWKILHOG0HWURSROLWDQ'LVWULFW1R DVHDFKDUHRUJDQL]HGXQGHUDQGJRYHUQHGE\WKLV6HUYLFH3ODQ District No. 1 BoundariesPHDQVWKHERXQGDULHVRIWKHDUHDOHJDOO\GHVFULEHGLQExhibit A-1DWWDFKHGKHUHWRDQGLQFRUSRUDWHGE\UHIHUHQFHDQGDVGHSLFWHGLQWKH'LVWULFW1R%RXQGDU\ 0DS District No. 2 BoundariesPHDQVWKHERXQGDULHVRIWKHDUHDOHJDOO\GHVFULEHGLQExhibit A-2DWWDFKHGKHUHWRDQGLQFRUSRUDWHGE\UHIHUHQFHDQGDVGHSLFWHGLQWKH'LVWULFW1R%RXQGDU\ 0DS District No. 3 BoundariesPHDQVWKHERXQGDULHVRIWKHDUHDOHJDOO\GHVFULEHGLQExhibit A-3DWWDFKHGKHUHWRDQGLQFRUSRUDWHGE\UHIHUHQFHDQGDVGHSLFWHGLQWKH'LVWULFW1R%RXQGDU\ 0DS District No. 1 Boundary MapPHDQVWKHPDSRIWKH'LVWULFW1R%RXQGDULHVDWWDFKHG KHUHWRDVExhibit B-1DQGLQFRUSRUDWHGE\UHIHUHQFH District No. 2 Boundary MapPHDQVWKHPDSRIWKH'LVWULFW1R%RXQGDULHVDWWDFKHG KHUHWRDVExhibit B-2DQGLQFRUSRUDWHGE\UHIHUHQFH District No. 3 Boundary MapPHDQVWKHPDSRIWKH'LVWULFW1R%RXQGDULHVDWWDFKHG KHUHWRDVExhibit B-3DQGLQFRUSRUDWHGE\UHIHUHQFH  DistrictsPHDQV1RUWKILHOG0HWURSROLWDQ'LVWULFW1R1RUWKILHOG0HWURSROLWDQ'LVWULFW 1RDQG1RUWKILHOG0HWURSROLWDQ'LVWULFW1RFROOHFWLYHO\RUJDQL]HGXQGHUDQGJRYHUQHGE\ WKLV6HUYLFH3ODQ End UserPHDQVDQ\RZQHURUWHQDQWRIDQ\RZQHURIDQ\SURSHUW\ZLWKLQWKH'LVWULFWV ZKRLVLQWHQGHGWREHFRPHEXUGHQHGE\WKHLPSRVLWLRQRIDGYDORUHPSURSHUW\WD[HVDQGRU)HHV %\ZD\RILOOXVWUDWLRQDUHVLGHQWKRPHRZQHUUHQWHUFRPPHUFLDOSURSHUW\RZQHURUFRPPHUFLDO WHQDQWLVDQ(QG8VHU$'HYHORSHUDQGDQ\SHUVRQRUHQWLW\WKDWFRQVWUXFWVKRPHVRUFRPPHUFLDO VWUXFWXUHVLVQRWDQ(QG8VHU External Financial AdvisorPHDQVDFRQVXOWDQWWKDW   Public Improvements PHDQV WKH LPSURYHPHQWV DQG LQIUDVWUXFWXUH WKH 'LVWULFWV DUH DXWKRUL]HGE\WKLV6HUYLFH3ODQWRIXQGDQGFRQVWUXFWIRUWKH3ODQQHG'HYHORSPHQWWRVHUYHWKH IXWXUHWD[SD\HUVDQGLQKDELWDQWVRIWKH'LVWULFWVH[FHSWDVVSHFLILFDOO\SURKLELWHGRUOLPLWHGLQWKLV 6HUYLFH 3ODQ  3XEOLF ,PSURYHPHQWV VKDOO LQFOXGH ZLWKRXW OLPLWDWLRQ WKH LPSURYHPHQWV DQG LQIUDVWUXFWXUH GHVFULEHG LQ Exhibit F DWWDFKHG KHUHWR DQG LQFRUSRUDWHG E\ UHIHUHQFH  3XEOLF ,PSURYHPHQWVGRQRWLQFOXGH5HJLRQDO,PSURYHPHQWV Regional ImprovementsPHDQVDQ\UHJLRQDOSXEOLFLPSURYHPHQWLGHQWLILHGE\WKH&LW\ IRUIXQGLQJLQZKROHRUSDUWE\D5HJLRQDO0LOO/HY\OHYLHGE\WKH'LVWULFWVLQFOXGLQJZLWKRXW OLPLWDWLRQWKHSXEOLFLPSURYHPHQWVGHVFULEHGLQExhibit IDWWDFKHGKHUHWRDQGLQFRUSRUDWHGE\ UHIHUHQFH Regional Mill LevyPHDQVWKHSURSHUW\WD[PLOOOHY\LPSRVHGRQ7D[DEOH3URSHUW\IRU WKHSXUSRVHRISODQQLQJGHVLJQLQJDFTXLULQJIXQGLQJFRQVWUXFWLQJLQVWDOOLQJUHORFDWLQJDQGRU UHGHYHORSLQJWKH5HJLRQDO,PSURYHPHQWVDQGRUWRIXQGWKHDGPLQLVWUDWLRQDQGRYHUKHDGFRVWV UHODWHGWRWKH5HJLRQDO,PSURYHPHQWVDVSURYLGHGLQ6HFWLRQ;RIWKLV6HUYLFH3ODQ Service Area PHDQV WKH SURSHUW\ FROOHFWLYHO\ ZLWKLQ WKH 'LVWULFW 1R  %RXQGDULHV 'LVWULFW1R%RXQGDULHVDQG'LVWULFW1R%RXQGDULHVDOODVPD\EHDPHQGHGIURPWLPHWRWLPH DVIXUWKHUVHWIRUWKLQWKLV6HUYLFH3ODQDQGWKH6SHFLDO'LVWULFW$FW Special District ActPHDQV$UWLFOHLQ7LWOHRIWKH&RORUDGR5HYLVHG6WDWXWHVDV DPHQGHG Service PlanPHDQVWKLVVHUYLFHSODQIRUWKH'LVWULFWVDSSURYHGE\WKH&LW\&RXQFLO Service Plan AmendmentPHDQVDPDWHULDOPRGLILFDWLRQRIWKH6HUYLFH3ODQDSSURYHG E\WKH&LW\&RXQFLOLQDFFRUGDQFHZLWKWKH6SHFLDO'LVWULFW$FWWKLV6HUYLFH3ODQDQGDQ\RWKHU DSSOLFDEOHODZ StatePHDQVWKH6WDWHRI&RORUDGR TABORPHDQV&RORUDGR¶V 7D[SD\HU¶V %LOO RI 5LJKWV LQ $UWLFOH ; 6HFWLRQ  RI WKH &RORUDGR&RQVWLWXWLRQ Taxable PropertyPHDQVWKHUHDODQGSHUVRQDOSURSHUW\ZLWKLQWKH6HUYLFH$UHDWKDWZLOO EHVXEMHFWWRWKHDGYDORUHPSURSHUW\WD[HVLPSRVHGE\WKH'LVWULFWV Vicinity MapPHDQVWKHPDSDWWDFKHGKHUHWRDVExhibit EDQGLQFRUSRUDWHGE\UHIHUHQFH GHSLFWLQJWKHORFDWLRQRIWKH6HUYLFH$UHDZLWKLQWKHUHJLRQDODUHDVXUURXQGLQJLW III. BOUNDARIES AND LOCATION 7KHDUHDRIWKH6HUYLFH$UHDLQFOXGHVDSSUR[LPDWHO\DFUHV$OHJDOGHVFULSWLRQDQG PDS RI WKH 'LVWULFW 1R  %RXQGDULHV DUH DWWDFKHG KHUHWR DV Exhibit A-1 DQG Exhibit B-1 UHVSHFWLYHO\DOHJDOGHVFULSWLRQDQGPDSRIWKH'LVWULFW1R%RXQGDULHVDUHDWWDFKHGKHUHWRDV Exhibit A-2DQGExhibit B-2UHVSHFWLYHO\DQGDOHJDOGHVFULSWLRQDQGPDSRIWKH'LVWULFW1R %RXQGDULHVDUHDWWDFKHGKHUHWRDVExhibit A-3DQGExhibit B-3UHVSHFWLYHO\,WLVDQWLFLSDWHGWKDW  WKH'LVWULFWV¶%RXQGDULHVPD\H[SDQGRUFRQWUDFWIURPWLPHWRWLPHDVWKH'LVWULFWVXQGHUWDNH LQFOXVLRQVRUH[FOXVLRQVSXUVXDQWWRWKH6SHFLDO'LVWULFW$FWVXEMHFWWRWKHOLPLWDWLRQVVHWIRUWKLQ 6HFWLRQ9RIWKLV6HUYLFH3ODQ7KHORFDWLRQRIWKH6HUYLFH$UHDLVGHSLFWHGLQWKHYLFLQLW\PDS DWWDFKHGDVExhibit E IV. DESCRIPTION OF PROJECT, PLANNED DEVELOPMENT, PUBLIC BENEFITS & ASSESSED VALUATION A. Project and Planned Development. 6LWXDWHGZLWKLQZDONLQJGLVWDQFHRIWKH&LW\¶V2OG7RZQWKH3ODQQHG'HYHORSPHQW LVDSURSRVHGDFUHPL[HGXVHFRPPXQLW\ORFDWHGZHVWRI/LQGHQPHLHU5RDGVRXWKHDVWRI WKH/DNH&DQDODQGQRUWKRIWKHWREHGHVLJQDWHGKLVWRULF$OWD9LVWDQHLJKERUKRRG7KH3ODQQHG 'HYHORSPHQWWDUJHWVDQXPEHURIWKH&LW\¶VVWUHWFKRXWFRPHVDQGFULWLFDOREMHFWLYHVLQFOXGLQJ QHLJKERUKRRGOLYDELOLW\DQGVRFLDOKHDOWKHQYLURQPHQWDOKHDOWKDQGWUDQVSRUWDWLRQ7KH3ODQQHG 'HYHORSPHQWLQFRUSRUDWHVJRDOVRIWKHIROORZLQJSODQVWKH&LW\3ODQ7UDQVSRUWDWLRQ0DVWHU3ODQ 0DVWHU 6WUHHW 3ODQ 1DWXUH LQ WKH &LW\ 6WUDWHJLF 3ODQ 1DWXUDO $UHDV 0DVWHU 3ODQ 3DYHG 5HFUHDWLRQDO 7UDLO 0DVWHU 3ODQ 1RUWKVLGH 1HLJKERUKRRGV 3ODQ 3HGHVWULDQ 3ODQ DQG %LF\FOH 0DVWHU3ODQ 7KH3ODQQHG'HYHORSPHQWLVDQWLFLSDWHGWRLQFOXGHDSSUR[LPDWHO\  DWWDFKHG KRXVLQJXQLWVRIZKLFKDPLQLPXPRIVL[W\ILYH   7KHUHIRUHQRWZLWKVWDQGLQJDQ\SURYLVLRQWRWKHFRQWUDU\FRQWDLQHGLQWKLV6HUYLFH 3ODQQR'LVWULFWVKDOOEHDXWKRUL]HGWRLVVXHDQ\'HEWRUWRLPSRVHD'HEW0LOO/HY\RUDQ\)HHV IRUSD\PHQWRI'HEWXQOHVVDQGXQWLOWKHGHOLYHU\RIWKH3XEOLF%HQHILWVVSHFLILFDOO\UHODWHGWRWKH SKDVHRIWKH3ODQQHG'HYHORSPHQWRUSRUWLRQRIWKH3URMHFWWREHILQDQFHGZLWKVXFK'HEW'HEW 0LOO /HY\ RU )HHV DUH VHFXUHG LQ D PDQQHU DSSURYHG E\ WKH &LW\ &RXQFLO  7R VDWLVI\ WKLV SUHFRQGLWLRQWRWKHLVVXDQFHRI'HEWDQGWRWKHLPSRVLWLRQRIWKH'HEW0LOO/HY\DQG)HHVGHOLYHU\ RIWKH3XEOLF%HQHILWVIRUHDFKSKDVHRIWKH3URMHFWDQGWKH3ODQQHG'HYHORSPHQWPXVWEHVHFXUHG E\RQHRIWKHIROORZLQJPHWKRGVDVDSSOLFDEOH  )RUDQ\SRUWLRQRIWKH3XEOLF%HQHILWVWREHSURYLGHGE\RQHRUPRUHRIWKH 'LVWULFWVHDFKVXFK'LVWULFWPXVWHQWHULQWRDQLQWHUJRYHUQPHQWDODJUHHPHQWZLWKWKH&LW\HLWKHU L  VI. DISTRICT GOVERNANCE 7KH'LVWULFWV¶%RDUGVVKDOOEHFRPSULVHGRISHUVRQVZKRDUHDTXDOLILHG³eligible elector´ RIWKH'LVWULFWVDVSURYLGHGLQWKH6SHFLDO'LVWULFW$FW,WLVDQWLFLSDWHGWKDWRYHUWLPHWKH(QG 8VHUVZKRDUHHOLJLEOHHOHFWRUVZLOODVVXPHGLUHFWHOHFWRUDOFRQWURORIWKH'LVWULFWV¶%RDUGVDV GHYHORSPHQWRIWKH6HUYLFH$UHDSURJUHVVHV7KH'LVWULFWVVKDOOQRWHQWHULQWRDQ\DJUHHPHQWE\ ZKLFKWKH(QG8VHUV¶HOHFWRUDOFRQWURORIWKH%RDUGVLVUHPRYHGRUGLPLQLVKHG VII. AUTHORIZED AND PROHIBITED POWERS A. General Grant of Powers. 7KH 'LVWULFWV VKDOO KDYH WKH SRZHU DQG DXWKRULW\ WR SURYLGH WKH 3XEOLF ,PSURYHPHQWV WKH 5HJLRQDO ,PSURYHPHQWV DQG UHODWHG RSHUDWLRQ DQG PDLQWHQDQFH VHUYLFHV LQFOXGLQJGHVLJQUHYLHZDQGFRYHQDQWHQIRUFHPHQWVHUYLFHVZLWKLQDQGZLWKRXWWKH6HUYLFH$UHD DVVXFKSRZHUVDQGDXWKRULWLHVDUHGHVFULEHGLQWKH6SHFLDO'LVWULFW$FWRWKHUDSSOLFDEOH6WDWHODZ FRPPRQODZDQGWKH&RORUDGR&RQVWLWXWLRQVXEMHFWWRWKHSURKLELWLRQVUHVWULFWLRQVDQGOLPLWDWLRQV VHWIRUWKLQWKLV6HUYLFH3ODQ ,IDIWHUWKH6HUYLFH3ODQLVDSSURYHGDQ\6WDWHODZLVHQDFWHGWRJUDQWDGGLWLRQDO SRZHUV RU DXWKRULW\ WR PHWURSROLWDQ GLVWULFWV E\ DPHQGPHQW RI WKH 6SHFLDO 'LVWULFW $FW RU RWKHUZLVHVXFKSRZHUVDQGDXWKRULW\VKDOOEHGHHPHGWREHDSDUWKHUHRI7KHVHQHZSRZHUVDQG DXWKRULW\VKDOORQO\EHDYDLODEOHWREHH[HUFLVHGE\WKH'LVWULFWVLIWKH&LW\&RXQFLOILUVWDSSURYHV D6HUYLFH3ODQ$PHQGPHQWWRVSHFLILFDOO\DOORZWKHH[HUFLVHRIVXFKSRZHUVRUDXWKRULW\E\WKH 'LVWULFWV B. Prohibited Improvements and Services and other Restrictions and Limitations. 7KH 'LVWULFWV¶ SRZHUV DQG DXWKRULW\ XQGHU WKLV 6HUYLFH 3ODQ WR SURYLGH 3XEOLF ,PSURYHPHQWVDQGVHUYLFHVDQGWRRWKHUZLVHH[HUFLVHLWVRWKHUSRZHUVDQGDXWKRULW\XQGHUWKH 6SHFLDO 'LVWULFW $FW DQG RWKHU DSSOLFDEOH 6WDWH ODZ DUH SURKLELWHG UHVWULFWHG DQG OLPLWHG DV KHUHDIWHUSURYLGHG)DLOXUHWRFRPSO\ZLWKWKHVHSURKLELWLRQVUHVWULFWLRQVDQGOLPLWDWLRQVVKDOO FRQVWLWXWHDPDWHULDOPRGLILFDWLRQXQGHUWKLV6HUYLFH3ODQDQGVKDOOHQWLWOHWKH&LW\WRSXUVXHDOO UHPHGLHVDYDLODEOHDWODZDQGLQHTXLW\DVSURYLGHGLQ6HFWLRQV;9,,DQG;9,,,RIWKLV6HUYLFH 3ODQ  (PLQHQW'RPDLQ5HVWULFWLRQ 7KH'LVWULFWVVKDOOQRWH[HUFLVH WKHLUVWDWXWRU\SRZHURIHPLQHQWGRPDLQ ZLWKRXWILUVWREWDLQLQJUHVROXWLRQDSSURYDOIURPWKH&LW\&RXQFLO7KLVUHVWULFWLRQRQWKH'LVWULFWV¶ H[HUFLVHRIWKHLUHPLQHQWGRPDLQSRZHULVEHLQJYROXQWDULO\DFTXLHVFHGWRE\WKH'LVWULFWVDQG VKDOOQRWEHLQWHUSUHWHGLQDQ\ZD\DVDOLPLWDWLRQRQWKH'LVWULFWV¶VRYHUHLJQSRZHUVDQGVKDOOQRW QHJDWLYHO\ DIIHFW WKH'LVWULFWV¶VWDWXVDVSROLWLFDOVXEGLYLVLRQVRIWKH6WDWHDVFRQIHUUHGE\ WKH 6SHFLDO'LVWULFW$FW    )HH/LPLWDWLRQ $Q\)HHVLPSRVHGIRUWKHUHSD\PHQWRI'HEWLIDXWKRUL]HGE\WKLV6HUYLFH 3ODQVKDOOQRWEHLPSRVHGE\WKH'LVWULFWVXSRQRUFROOHFWHGIURPDQ(QG8VHU,QDGGLWLRQ)HHV LPSRVHG IRU WKH SD\PHQW RI 'HEW VKDOO QRW EH LPSRVHG XQOHVV DQG XQWLO WKH UHTXLUHPHQWV IRU VHFXULQJWKHGHOLYHU\RIWKH'LVWULFW¶V SRUWLRQ RI WKH 3XEOLF %HQHILWV KDYH EHHQ VDWLVILHG LQ DFFRUGDQFH ZLWK 6HFWLRQ ,9% RI WKLV 6HUYLFH 3ODQ  1RWZLWKVWDQGLQJ WKH IRUHJRLQJ WKLV )HH OLPLWDWLRQ VKDOO QRW DSSO\ WR DQ\ )HH LPSRVHG WR IXQG WKH RSHUDWLRQ PDLQWHQDQFH UHSDLU RU UHSODFHPHQWRI3XEOLF,PSURYHPHQWVRUWKHDGPLQLVWUDWLRQRIWKH'LVWULFWV  2SHUDWLRQVDQG0DLQWHQDQFH 7KH SULPDU\ SXUSRVH RI WKH 'LVWULFWV LV WR SODQ IRU GHVLJQ DFTXLUH FRQVWUXFWLQVWDOOUHORFDWHUHGHYHORSDQGILQDQFHWKH3XEOLF,PSURYHPHQWV7KH'LVWULFWVVKDOO GHGLFDWH WKH 3XEOLF ,PSURYHPHQWV WR WKH &LW\ RU RWKHU DSSURSULDWH MXULVGLFWLRQ RU RZQHUV¶ DVVRFLDWLRQ LQ D PDQQHU FRQVLVWHQW ZLWK WKH $SSURYHG 'HYHORSPHQW 3ODQ DQG WKH &LW\ &RGH SURYLGHG WKDW QRWKLQJ KHUHLQ UHTXLUHV WKH &LW\ WRDFFHSWDGHGLFDWLRQ  7KH 'LVWULFWV DUH HDFK VSHFLILFDOO\DXWKRUL]HGWRRSHUDWHDQGPDLQWDLQDOORUDQ\SDUWRUDOORIWKH3XEOLF,PSURYHPHQWV QRWRWKHUZLVHFRQYH\HGRUGHGLFDWHGWRWKH&LW\RUDQRWKHUDSSURSULDWHJRYHUQPHQWDOHQWLW\XQWLO VXFKWLPHDVWKH'LVWULFWLVGLVVROYHG  )LUH3URWHFWLRQ5HVWULFWLRQ 7KH 'LVWULFWV DUH QRW DXWKRUL]HG WR SODQ IRU GHVLJQ DFTXLUH FRQVWUXFW LQVWDOOUHORFDWHUHGHYHORSILQDQFHRZQRSHUDWHRUPDLQWDLQILUHSURWHFWLRQIDFLOLWLHVRUVHUYLFHV XQOHVVVXFKIDFLOLWLHVDQGVHUYLFHVDUHSURYLGHGSXUVXDQWWRDQLQWHUJRYHUQPHQWDODJUHHPHQWZLWK WKH3RXGUH)LUH$XWKRULW\7KHDXWKRULW\WRSODQIRUGHVLJQDFTXLUHFRQVWUXFWLQVWDOOUHORFDWH UHGHYHORSILQDQFHRSHUDWHRUPDLQWDLQILUHK\GUDQWVDQGUHODWHGLPSURYHPHQWVLQVWDOOHGDVSDUWRI WKH3URMHFW¶VZDWHUV\VWHPVKDOOQRWEHOLPLWHGE\WKLVVXEVHFWLRQ  3XEOLF6DIHW\6HUYLFHV5HVWULFWLRQ 7KH 'LVWULFWV DUH QRW DXWKRUL]HG WR SURYLGH SROLFLQJ RU RWKHU VHFXULW\ VHUYLFHV+RZHYHUWKH'LVWULFWVPD\SXUVXDQWWR&56†    RSHUDWH RU PDLQWDLQ D JROI FRXUVH XQOHVV VXFK DFWLYLW\ LV SXUVXDQW WR DQ LQWHUJRYHUQPHQWDO DJUHHPHQWZLWKWKH&LW\DSSURYHGE\WKH&LW\&RXQFLO  7HOHYLVLRQ5HOD\DQG7UDQVODWLRQ5HVWULFWLRQ 7KH 'LVWULFWV DUH QRW DXWKRUL]HG WR SODQ IRU GHVLJQ DFTXLUH FRQVWUXFW LQVWDOO UHORFDWH UHGHYHORS ILQDQFH RZQ RSHUDWH RU PDLQWDLQ WHOHYLVLRQ UHOD\ DQG WUDQVODWLRQ IDFLOLWLHVDQGVHUYLFHVRWKHUWKDQIRUWKHLQVWDOODWLRQRIFRQGXLWDVDSDUWRIDVWUHHWFRQVWUXFWLRQ SURMHFWXQOHVVVXFKIDFLOLWLHVDQGVHUYLFHVDUHSURYLGHGSXUVXDQWWRSULRUZULWWHQDSSURYDOIURPWKH &LW\&RXQFLODVD6HUYLFH3ODQ$PHQGPHQW  3RWDEOH:DWHUDQG:DVWHZDWHU7UHDWPHQW)DFLOLWLHV $FNQRZOHGJLQJWKDWWKH&LW\DQGRWKHUH[LVWLQJVSHFLDOGLVWULFWVRSHUDWLQJ ZLWKLQWKH&LW\FXUUHQWO\RZQDQGRSHUDWHWUHDWPHQWIDFLOLWLHVIRUSRWDEOHZDWHUDQGZDVWHZDWHU WKDW DUH DYDLODEOHWRSURYLGHVHUYLFHVWRWKH6HUYLFH$UHD WKH'LVWULFWVVKDOOQRWSODQGHVLJQ DFTXLUHFRQVWUXFWLQVWDOOUHORFDWHUHGHYHORSILQDQFHRZQRSHUDWHRUPDLQWDLQVXFKIDFLOLWLHV ZLWKRXWREWDLQLQJWKH&LW\&RXQFLO¶VSULRUZULWWHQDSSURYDOHLWKHUE\LQWHUJRYHUQPHQWDODJUHHPHQW RUDVD6HUYLFH3ODQ$PHQGPHQW  6DOHVDQG8VH7D[([HPSWLRQ/LPLWDWLRQ 7KH'LVWULFWVVKDOOQRWH[HUFLVHDQ\VDOHVDQGXVHWD[H[HPSWLRQRWKHUZLVH DYDLODEOHWRWKH'LVWULFWVXQGHUWKH&LW\&RGH  6XEGLVWULFW5HVWULFWLRQ 7KH'LVWULFWVVKDOOQRWFUHDWHDQ\VXEGLVWULFWSXUVXDQWWRWKH6SHFLDO'LVWULFW $FWZLWKRXWWKHSULRUZULWWHQDSSURYDORIWKH&LW\&RXQFLO  3ULYDWHO\3ODFHG'HEW/LPLWDWLRQ 3ULRUWRWKHLVVXDQFHRIDQ\SULYDWHO\SODFHG'HEWWKH'LVWULFWVVKDOOREWDLQ WKHFHUWLILFDWLRQRIDQ([WHUQDO)LQDQFLDO$GYLVRUVXEVWDQWLDOO\DVIROORZV :HDUH>,DP@DQ([WHUQDO)LQDQFLDO$GYLVRUZLWKLQ WKHPHDQLQJRIWKH'LVWULFW¶V6HUYLFH3ODQ :H>,@FHUWLI\WKDW    SURYLVLRQV LV UHDVRQDEOH FRQVLGHULQJ WKH ILQDQFLDO FLUFXPVWDQFHVRIWKH'LVWULFW  6SHFLDO$VVHVVPHQWV 7KH'LVWULFWVVKDOOQRWLPSRVHVSHFLDODVVHVVPHQWVZLWKRXWWKHSULRUZULWWHQ DSSURYDORIWKH&LW\&RXQFLO VIII. PUBLIC IMPROVEMENTS AND ESTIMATED COSTS Exhibit FVXPPDUL]HVWKHW\SHRI3XEOLF,PSURYHPHQWVWKDWDUHSURMHFWHGWREHFRQVWUXFWHG DQGRULQVWDOOHGE\WKH'LVWULFWV7KHFRVWVFRSHDQGGHILQLWLRQRIVXFK3XEOLF,PSURYHPHQWVPD\ YDU\RYHUWLPH7KHWRWDOHVWLPDWHGFRVWVRI3XEOLF,PSURYHPHQWV DV VHW IRUWK LQExhibit F H[FOXGLQJDQ\LPSURYHPHQWVSDLGIRUE\WKH5HJLRQDO0LOO/HY\QHFHVVDU\WRVHUYHWKH3ODQQHG 'HYHORSPHQWDUHDSSUR[LPDWHO\LQGROODUV7KHFRVWHVWLPDWHVDUHEDVHGXSRQ SUHOLPLQDU\HQJLQHHULQJDUFKLWHFWXUDOVXUYH\VDQGUHYLHZVRIWKH3XEOLF,PSURYHPHQWVVHWIRUWK LQExhibit FDQGLQFOXGHDOOFRQVWUXFWLRQFRVWHVWLPDWHVWRJHWKHUZLWKHVWLPDWHVRIFRVWVVXFKDV ODQGDFTXLVLWLRQHQJLQHHULQJVHUYLFHVOHJDOH[SHQVHVDQGRWKHUDVVRFLDWHGH[SHQVHV0DSVRIWKH DQWLFLSDWHGORFDWLRQRSHUDWLRQDQGPDLQWHQDQFHRI3XEOLF,PSURYHPHQWVDUHDWWDFKHGKHUHWRDV Exhibit G&KDQJHVLQWKH3XEOLF,PSURYHPHQWVRUFRVWZKLFKDUHDSSURYHGE\WKH&LW\LQDQ $SSURYHG'HYHORSPHQW3ODQDQGDQ\DJUHHPHQWDSSURYHGE\WKH&LW\&RXQFLOSXUVXDQWWR6HFWLRQ ,9%RIWKLV6HUYLFH3ODQVKDOOQRWFRQVWLWXWHD6HUYLFH3ODQ$PHQGPHQW,QDGGLWLRQGXHWRWKH SUHOLPLQDU\QDWXUHRIWKH3URMHFWWKH&LW\VKDOOQRWEHERXQGE\WKLV6HUYLFH3ODQLQUHYLHZLQJDQG DSSURYLQJWKH$SSURYHG'HYHORSPHQW3ODQDQGWKH$SSURYHG'HYHORSPHQW3ODQVKDOOVXSHUVHGH WKH6HUYLFH3ODQZLWKUHJDUGWRWKHFRVWVFRSHDQGGHILQLWLRQRI3XEOLF,PSURYHPHQWV3URYLGHG KRZHYHUDQ\DJUHHPHQWDSSURYHGDQGHQWHUHGLQWRSXUVXDQWWR6HFWLRQ,9%RIWKLV6HUYLFH3ODQ IRUWKHSURYLVLRQRID3XEOLF,PSURYHPHQWWKDWLVDOVRD3XEOLF%HQHILWVKDOOVXSHUVHGHERWKWKLV 6HUYLFH3ODQDQGWKH$SSURYHG'HYHORSPHQW3ODQ ([FHSWDVRWKHUZLVHSURYLGHGE\DQDJUHHPHQWDSSURYHGXQGHU6HFWLRQ,9%RIWKLV6HUYLFH 3ODQ L   7KH &LW\ &RGH KDV GHYHORSPHQW VWDQGDUGV FRQWUDFWLQJ UHTXLUHPHQWV DQG RWKHU OHJDO UHTXLUHPHQWVUHODWHGWRWKHFRQVWUXFWLRQDQGSD\PHQWRISXEOLFLPSURYHPHQWVDQGUHODWHGWRFHUWDLQ RSHUDWLRQDFWLYLWLHV5HODWLQJWRWKHVHWKH'LVWULFWVVKDOOFRPSO\ZLWKWKHIROORZLQJUHTXLUHPHQWV A. Development Standards. 7KH 'LVWULFWV VKDOO HQVXUH WKDW WKH 3XEOLF ,PSURYHPHQWV DUH GHVLJQHG DQG FRQVWUXFWHG LQDFFRUGDQFHZLWKWKHVWDQGDUGVDQGVSHFLILFDWLRQVRIWKH&LW\&RGHDQGRIRWKHU JRYHUQPHQWDOHQWLWLHVKDYLQJSURSHUMXULVGLFWLRQDVDSSOLFDEOH7KH'LVWULFWVGLUHFWO\RULQGLUHFWO\ WKURXJKDQ\'HYHORSHUZLOOREWDLQWKH&LW\¶VDSSURYDORIFLYLOHQJLQHHULQJSODQVDQGZLOOREWDLQ DSSOLFDEOHSHUPLWVIRUFRQVWUXFWLRQDQGLQVWDOODWLRQRI3XEOLF,PSURYHPHQWVSULRUWRSHUIRUPLQJ VXFKZRUN8QOHVVZDLYHGE\WKH&LW\&RXQFLOWKH'LVWULFWVVKDOOEHUHTXLUHGLQDFFRUGDQFHZLWK WKH&LW\&RGHWRSRVWDVXUHW\ERQGOHWWHURIFUHGLWRURWKHUDSSURYHGGHYHORSPHQWVHFXULW\IRU DQ\3XEOLF,PSURYHPHQWVWREHFRQVWUXFWHGE\WKH'LVWULFWV6XFKGHYHORSPHQWVHFXULW\PD\EH UHOHDVHG LQ WKH &LW\ 0DQDJHU¶V GLVFUHWLRQ ZKHQ WKH FRQVWUXFWLQJ 'LVWULFW KDV REWDLQHG IXQGV WKURXJK 'HEW LVVXDQFH RU RWKHUZLVH DGHTXDWH WR LQVXUH WKH FRQVWUXFWLRQ RI WKH 3XEOLF ,PSURYHPHQWVXQOHVVVXFKUHOHDVHLVSURKLELWHGE\RULQFRQIOLFWZLWKDQ\&LW\&RGHSURYLVLRQ 6WDWHODZRUDQ\DJUHHPHQWDSSURYHGDQGHQWHUHGLQWRXQGHU6HFWLRQ,9%RIWKLV6HUYLFH3ODQ $Q\OLPLWDWLRQRUUHTXLUHPHQWFRQFHUQLQJWKHWLPHZLWKLQZKLFKWKH&LW\PXVWUHYLHZWKH'LVWULFWV¶ SURSRVDORUDSSOLFDWLRQIRUDQ$SSURYHG'HYHORSPHQW3ODQRURWKHUODQGXVHDSSURYDOLVKHUHE\ ZDLYHGE\WKH'LVWULFWV B. Contracting. 7KH'LVWULFWVVKDOOFRPSO\ZLWKDOODSSOLFDEOH6WDWHSXUFKDVLQJSXEOLFELGGLQJDQG FRQVWUXFWLRQFRQWUDFWLQJUHTXLUHPHQWVDQGOLPLWDWLRQV C. Land Acquisition and Conveyance. 7KHSXUFKDVHSULFHRIDQ\ODQGRULPSURYHPHQWVDFTXLUHGE\WKH'LVWULFWVIURPWKH 'HYHORSHUVKDOOEHQRPRUHWKDQWKHWKHQFXUUHQWIDLUPDUNHWYDOXHDVFRQILUPHGE\DQLQGHSHQGHQW 0$,DSSUDLVDOIRUODQGDQGE\DQLQGHSHQGHQWSURIHVVLRQDOHQJLQHHUIRULPSURYHPHQWV/DQG HDVHPHQWVLPSURYHPHQWVDQGIDFLOLWLHVFRQYH\HGWRWKH&LW\VKDOOEHIUHHDQGFOHDURIDOOOLHQV HQFXPEUDQFHV DQG HDVHPHQWV XQOHVV RWKHUZLVH DSSURYHG E\ WKH &LW\ 0DQDJHU SULRU WR FRQYH\DQFH$OOFRQYH\DQFHVWRWKH&LW\VKDOOEHE\VSHFLDOZDUUDQW\GHHGVKDOOEHFRQYH\HGDW QR FRVW WR WKH &LW\ VKDOO LQFOXGH DQ $/7$ WLWOH SROLF\ LVVXHG WR WKH &LW\ VKDOO PHHW WKH HQYLURQPHQWDOVWDQGDUGVRIWKH&LW\DQGVKDOOFRPSO\ZLWKDQ\RWKHUFRQYH\DQFHSUHUHTXLVLWHV UHTXLUHGLQWKH&LW\&RGH D. Equal Employment and Discrimination. ,QFRQQHFWLRQZLWKWKHSHUIRUPDQFHRIDOODFWVRUDFWLYLWLHVKHUHXQGHUWKH'LVWULFWV VKDOOQRWGLVFULPLQDWHDJDLQVWDQ\SHUVRQRWKHUZLVHTXDOLILHGZLWKUHVSHFWWRLWVKLULQJGLVFKDUJLQJ SURPRWLQJ RU GHPRWLQJ RU LQ PDWWHUV RI FRPSHQVDWLRQ VROHO\ EHFDXVH RI UDFH FRORU UHOLJLRQ QDWLRQDO RULJLQ JHQGHU DJH PLOLWDU\ VWDWXV VH[XDO RULHQWDWLRQ JHQGHU LGHQWLW\ RU JHQGHU H[SUHVVLRQPDULWDOVWDWXVRUSK\VLFDORUPHQWDOGLVDELOLW\DQGIXUWKHUVKDOOLQVHUWWKHIRUHJRLQJ SURYLVLRQLQFRQWUDFWVRUVXEFRQWUDFWVHQWHUHGLQWRE\WKH'LVWULFWVWRDFFRPSOLVKWKHSXUSRVHVRI WKLV6HUYLFH3ODQ   IX. FINANCIAL PLAN/PROPOSED DEBT 7KLV6HFWLRQ,;RIWKH6HUYLFH3ODQGHVFULEHVWKHQDWXUHEDVLVPHWKRGRIIXQGLQJDQG ILQDQFLQJ OLPLWDWLRQV DVVRFLDWHG ZLWK WKH DFTXLVLWLRQ FRQVWUXFWLRQ FRPSOHWLRQ UHSDLU UHSODFHPHQWRSHUDWLRQDQGPDLQWHQDQFHRI3XEOLF,PSURYHPHQWV A. Financial Plan. 7KH'LVWULFWV¶)LQDQFLDO3ODQDWWDFKHGDVExhibit HDQGLQFRUSRUDWHGE\UHIHUHQFH UHIOHFWV WKH 'LVWULFWV¶ DQWLFLSDWHG VFKHGXOHIRULQFXUULQJ'HEWWRIXQG3XEOLF,PSURYHPHQWVLQ VXSSRUWRIWKH3URMHFW7KH)LQDQFLDO3ODQDOVRUHIOHFWVWKHVFKHGXOHRIDOODQWLFLSDWHGUHYHQXHV IORZLQJ WR WKH'LVWULFWVGHULYHGIURPWKH'LVWULFWV¶PLOOOHYLHV)HHV LPSRVHGE\ WKH'LVWULFWV VSHFLILFRZQHUVKLSWD[HVDQGDOORWKHUDQWLFLSDWHGOHJDOO\DYDLODEOHUHYHQXHV7KH)LQDQFLDO3ODQ LVEDVHGRQHFRQRPLFSROLWLFDODQGLQGXVWU\ FRQGLWLRQV DV WKH\SUHVHQWO\ H[LVW DQG UHDVRQDEOH SURMHFWLRQV DQG HVWLPDWHV RI IXWXUH FRQGLWLRQV 7KHVHSURMHFWLRQVDQGHVWLPDWHVDUHQRWWREH LQWHUSUHWHGDVWKHRQO\PHWKRGRILPSOHPHQWDWLRQRIWKH'LVWULFW¶VJRDOVDQGREMHFWLYHVEXWUDWKHU DUHSUHVHQWDWLRQRIRQHIHDVLEOHDOWHUQDWLYH2WKHUILQDQFLDOVWUXFWXUHVPD\EHXVHGVRORQJDVWKH\ DUHLQFRPSOLDQFHZLWKWKLV6HUYLFH3ODQ7KH)LQDQFLDO3ODQLQFRUSRUDWHVDOORIWKHSURYLVLRQVRI WKLV6HFWLRQ,; %DVHG XSRQ WKH DVVXPSWLRQV FRQWDLQHG WKHUHLQ WKH )LQDQFLDO 3ODQ SURMHFWV WKH LVVXDQFHRI%RQGV WRIXQG3XEOLF,PSURYHPHQWVDQGDQWLFLSDWHG'HEWUHSD\PHQWEDVHGRQWKH GHYHORSPHQWDVVXPSWLRQVDQGDEVRUSWLRQVRIWKHSURSHUW\LQWKH6HUYLFH$UHDE\(QG8VHUV7KH )LQDQFLDO 3ODQ DQWLFLSDWHV WKDW WKH 'LVWULFWV ZLOO DFTXLUH FRQVWUXFW DQG FRPSOHWH DOO 3XEOLF ,PSURYHPHQWVQHHGHGWRVHUYHWKH6HUYLFH$UHD 7KH)LQDQFLDO3ODQGHPRQVWUDWHVWKDWWKH'LVWULFWVZLOOKDYHWKHILQDQFLDODELOLW\WR GLVFKDUJHDOO'HEWWREHLVVXHGDVSDUWRIWKH)LQDQFLDO3ODQRQDUHDVRQDEOHEDVLV)XUWKHUPRUH WKH'LVWULFWVZLOOVHFXUHWKHFHUWLILFDWLRQRIDQ([WHUQDO)LQDQFLDO$GYLVRUZKRZLOOSURYLGHDQ RSLQLRQDVWRZKHWKHUVXFK'HEWLVVXDQFHVDUHLQWKHEHVWLQWHUHVWRIWKH'LVWULFWVDWWKHWLPHRI LVVXDQFH B. Mill Levies. ,WLVDQWLFLSDWHGWKDWWKH'LVWULFWVZLOOLPSRVHD'HEW0LOO/HY\DQGDQ2SHUDWLQJ 0LOO/HY\RQDOOSURSHUW\ZLWKLQWKH6HUYLFH$UHD,QGRLQJVRWKHIROORZLQJVKDOODSSO\  $JJUHJDWH0LOO/HY\0D[LPXP 7KH$JJUHJDWH0LOO/HY\VKDOOQRWH[FHHGLQDQ\\HDUWKH$JJUHJDWH0LOO /HY\0D[LPXPZKLFKLVILIW\     2SHUDWLQJ0LOO/HY\ 7KH'LVWULFWVPD\HDFKLPSRVHDQ2SHUDWLQJ0LOO/HY\RIXSWRILIW\    C. Maximum Voted Interest Rate and Underwriting Discount. 7KHLQWHUHVWUDWHRQDQ\'HEWLVH[SHFWHGWREHWKHPDUNHWUDWHDWWKHWLPHWKH'HEW LVLVVXHG7KHPD[LPXPLQWHUHVWUDWHRQDQ\'HEWLQFOXGLQJDQ\GHIDXOWLQJLQWHUHVWUDWHLVQRW SHUPLWWHGWRH[FHHGWZHOYHSHUFHQW    VLJQHGOHWWHUIURPWKH([WHUQDO)LQDQFLDO$GYLVRUSURYLGLQJDQRIILFLDORSLQLRQRQWKHVWUXFWXUHRI WKH 'HEW VWDWLQJ WKH $GYLVRU¶V RSLQLRQ WKDW WKH FRVW RI LVVXDQFH VL]LQJ UHSD\PHQW WHUP UHGHPSWLRQ IHDWXUH FRXSRQLQJ FUHGLW VSUHDGV SD\PHQW FORVLQJ GDWH DQG RWKHU PDWHULDO WUDQVDFWLRQGHWDLOVRIWKHSURSRVHG'HEWVHUYHWKHEHVWLQWHUHVWRIWKHLVVXLQJ'LVWULFW 'HEWVKDOOQRWEHXQGHUWDNHQE\WKH'LVWULFWVLIIRXQGWREHXQUHDVRQDEOHE\WKH ([WHUQDO)LQDQFLDO$GYLVRU G. Disclosure to Debt Purchasers. $Q\'HEWRIWKH'LVWULFWVVKDOOVHWIRUWKDVWDWHPHQWLQVXEVWDQWLDOO\WKHIROORZLQJ IRUP %\DFFHSWDQFHRIWKLVLQVWUXPHQWWKHRZQHURIWKLV'HEWDJUHHVDQG FRQVHQWVWRDOORIWKHOLPLWDWLRQVZLWKUHVSHFWWRWKHSD\PHQWRIWKH SULQFLSDODQGLQWHUHVWRQWKLV'HEWFRQWDLQHGKHUHLQLQWKHUHVROXWLRQ RI WKH 'LVWULFW DXWKRUL]LQJ WKH LVVXDQFH RI WKLV 'HEW DQG LQ WKH 6HUYLFH3ODQRIWKH'LVWULFW7KLV'HEWLVQRWDQGFDQQRWEHD'HEW RIWKH&LW\RI)RUW&ROOLQV 6LPLODU ODQJXDJH GHVFULELQJ WKH OLPLWDWLRQV ZLWK UHVSHFW WR WKHSD\PHQWRIWKH SULQFLSDODQGLQWHUHVWRQ'HEWVHWIRUWKLQWKLV6HUYLFH3ODQVKDOOEHLQFOXGHGLQDQ\GRFXPHQWXVHG IRU WKH RIIHULQJ RI WKH 'HEW IRU VDOH WR SHUVRQVLQFOXGLQJEXWQRWOLPLWHGWRD'HYHORSHURI SURSHUW\ZLWKLQWKH6HUYLFH$UHD H. Security for Debt. 7KH'LVWULFWVVKDOOQRWSOHGJHDQ\UHYHQXHRUSURSHUW\RIWKH&LW\DVVHFXULW\IRU WKHLQGHEWHGQHVVVHWIRUWKLQWKLV6HUYLFH3ODQ$SSURYDORIWKLV6HUYLFH3ODQVKDOOQRWEHFRQVWUXHG DVDJXDUDQWHHE\WKH&LW\RISD\PHQWRIDQ\RIWKH'LVWULFWV¶REOLJDWLRQVQRUVKDOODQ\WKLQJLQWKH 6HUYLFH3ODQEHFRQVWUXHGWRFUHDWHDQ\UHVSRQVLELOLW\RUOLDELOLW\RQWKHSDUWRIWKH&LW\LQWKHHYHQW RIGHIDXOWE\WKH'LVWULFWVLQWKHSD\PHQWRIDQ\VXFKREOLJDWLRQ I. TABOR Compliance. 7KH'LVWULFWVVKDOOFRPSO\ZLWKWKHSURYLVLRQVRI7$%25,QWKHGLVFUHWLRQRIWKH 'LVWULFWV¶%RDUGVWKH'LVWULFWVPD\VHWXSRWKHUTXDOLI\LQJHQWLWLHVWRPDQDJHIXQGFRQVWUXFWDQG RSHUDWHIDFLOLWLHVVHUYLFHVDQGSURJUDPV7RWKHH[WHQWDOORZHGE\ODZDQ\HQWLW\FUHDWHGE\D 'LVWULFWZLOOUHPDLQXQGHUWKHFRQWURORIWKH'LVWULFW¶V%RDUG J. Districts’ Operating Costs. 7KH HVWLPDWHG FRVW RI DFTXLULQJ ODQG HQJLQHHULQJ VHUYLFHV OHJDO VHUYLFHV DQG DGPLQLVWUDWLYHVHUYLFHVWRJHWKHUZLWKWKHHVWLPDWHGFRVWVRIWKH'LVWULFWV¶RUJDQL]DWLRQDQGLQLWLDO RSHUDWLRQVDUHDQWLFLSDWHGWREH2QH+XQGUHG7KRXVDQG'ROODUV    ,QDGGLWLRQWRWKHFDSLWDOFRVWVRIWKH3XEOLF,PSURYHPHQWVWKH'LVWULFWVZLOOUHTXLUH RSHUDWLQJIXQGVIRUDGPLQLVWUDWLRQDQGWRSODQDQGFDXVHWKH3XEOLF,PSURYHPHQWVWREHRSHUDWHG DQG PDLQWDLQHG  7KH ILUVW \HDU¶V RSHUDWLQJ EXGJHW LV HVWLPDWHG WR EH )LIW\ 7KRXVDQG 'ROODUV    E. Expenditure of Regional Mil Levy Revenues. 5HYHQXH FROOHFWHG WKURXJK WKH LPSRVLWLRQ RI WKH 5HJLRQDO 0LOO /HY\ VKDOO EH H[SHQGHGDVIROORZV  ,QWHUJRYHUQPHQWDO$JUHHPHQW ,IWKH&LW\DQGWKH'LVWULFWVKDYHH[HFXWHGDQLQWHUJRYHUQPHQWDODJUHHPHQW FRQFHUQLQJWKH5HJLRQDO,PSURYHPHQWVWKHQWKHUHYHQXHIURPWKH5HJLRQDO0LOO/HY\VKDOOEH XVHGLQDFFRUGDQFHZLWKVXFKDJUHHPHQW  1R,QWHUJRYHUQPHQWDO$JUHHPHQW ,IQRLQWHUJRYHUQPHQWDODJUHHPHQWH[LVWVEHWZHHQWKH'LVWULFWVDQGWKH&LW\ WKHQWKHUHYHQXHIURPWKH5HJLRQDO0LOO/HY\VKDOOEHSDLGWRWKH&LW\IRUXVHE\WKH&LW\LQWKH SODQQLQJGHVLJQLQJFRQVWUXFWLQJLQVWDOOLQJDFTXLULQJUHORFDWLQJUHGHYHORSLQJRUILQDQFLQJRI 5HJLRQDO,PSURYHPHQWVZKLFKEHQHILWWKH(QG8VHUVRIWKH'LVWULFWVDVSULRULWL]HGDQGGHWHUPLQHG E\WKH&LW\ F. Regional Mill Levy Term. 7KHLPSRVLWLRQRIWKH5HJLRQDO0LOO/HY\VKDOOQRWH[FHHGDWHUPRIWZHQW\ILYH    QHLWKHUHQKDQFHGQRUGLPLQLVKHGDVDUHVXOWRIVXFKFKDQJHRFFXUULQJDIWHU-DQXDU\)RU SXUSRVHVRIWKHIRUHJRLQJDFKDQJHLQWKHUDWLRRIDFWXDOYDOXDWLRQWRDVVHVVHGYDOXDWLRQZLOOEHD FKDQJHLQWKHPHWKRGRIFDOFXODWLQJDVVHVVHGYDOXDWLRQ XI. CITY FEES 7KH'LVWULFWVVKDOOSD\DOODSSOLFDEOH&LW\IHHVDVUHTXLUHGE\WKH&LW\&RGH XII. BANKRUPTCY LIMITATIONS $OORIWKHOLPLWDWLRQVFRQWDLQHGLQWKLV6HUYLFH3ODQLQFOXGLQJEXWQRWOLPLWHGWRWKRVH SHUWDLQLQJWRWKH$JJUHJDWH0LOO/HY\0D[LPXP0D[LPXP'HEW0LOO/HY\,PSRVLWLRQ7HUPDQG )HHVKDYHEHHQHVWDEOLVKHGXQGHUWKHDXWKRULW\RIWKH&LW\LQWKH6SHFLDO'LVWULFW$FWWRDSSURYH WKLV6HUYLFH3ODQ,WLVH[SUHVVO\LQWHQGHGWKDWE\VXFKDSSURYDOVXFKOLPLWDWLRQV L    )LQDQFLDO6WDWHPHQWV ([FHSWZKHQDQH[HPSWLRQIURPDXGLWKDVEHHQJUDQWHGIRUWKHUHSRUW\HDU XQGHUWKH/RFDO*RYHUQPHQW$XGLW/DZWKHDXGLWHGILQDQFLDOVWDWHPHQWVRIWKH'LVWULFWIRUWKH UHSRUW\HDULQFOXGLQJDVWDWHPHQWRIILQDQFLDOFRQGLWLRQ LHEDODQFHVKHHW    $ VXPPDU\ RI DQ\ OLWLJDWLRQ ZKLFK LQYROYHV WKH 'LVWULFW¶V 3XEOLF ,PSURYHPHQWVDVRI'HFHPEHURIWKHUHSRUW\HDU  $OLVWRIDOOIDFLOLWLHVDQGLPSURYHPHQWVFRQVWUXFWHGE\WKH'LVWULFWWKDWKDYH EHHQGHGLFDWHGWRDQGDFFHSWHGE\WKH&LW\DVRI'HFHPEHURIWKHUHSRUW\HDU  1RWLFH RI DQ\ XQFXUHG HYHQWV RI GHIDXOW E\ WKH 'LVWULFWZKLFKFRQWLQXH EH\RQGDQLQHW\    $ $FWLRQVRUIDLOXUHVWRDFWWKDWFUHDWHPDWHULDOO\JUHDWHUILQDQFLDOULVNRUEXUGHQWR WKHWD[SD\HUVRIWKH'LVWULFWV % 3HUIRUPDQFH RI D VHUYLFH RU IXQFWLRQ FRQVWUXFWLRQ RI DQ LPSURYHPHQW RU DFTXLVLWLRQRIDPDMRUIDFLOLW\WKDWLVQRWFORVHO\UHODWHGWRDQLPSURYHPHQWVHUYLFHIXQFWLRQRU IDFLOLW\DXWKRUL]HGLQWKH6HUYLFH3ODQ & )DLOXUHWRSHUIRUPDVHUYLFHRUIXQFWLRQFRQVWUXFWDQLPSURYHPHQWRUDFTXLUHD IDFLOLW\UHTXLUHGE\WKH6HUYLFH3ODQDQG ' )DLOXUHWRFRPSO\ZLWKDQ\RIWKHSURKLELWLRQVOLPLWDWLRQVDQGUHVWULFWLRQVRIWKLV 6HUYLFH3ODQ XVI. DISSOLUTION 8SRQ LQGHSHQGHQW GHWHUPLQDWLRQ E\ WKH &LW\ &RXQFLO WKDW WKH SXUSRVHV IRU ZKLFK DQ\ 'LVWULFWZDVFUHDWHGKDYHEHHQDFFRPSOLVKHGVDLG'LVWULFWVKDOOILOHDSHWLWLRQLQGLVWULFWFRXUWIRU GLVVROXWLRQDVSURYLGHGLQWKH6SHFLDO'LVWULFW$FW,QQRHYHQWVKDOOGLVVROXWLRQRFFXUXQWLOWKH 'LVWULFWKDVSURYLGHGIRUWKHSD\PHQWRUGLVFKDUJHRIDOORILWVRXWVWDQGLQJLQGHEWHGQHVVDQGRWKHU ILQDQFLDOREOLJDWLRQVDVUHTXLUHGSXUVXDQWWR6WDWHODZ ,QDGGLWLRQLIZLWKLQWKUHH    % :LWKKROG WKH LVVXDQFH RI DQ\ SHUPLW DXWKRUL]DWLRQ DFFHSWDQFH RU RWKHU DGPLQLVWUDWLYHDSSURYDORUZLWKKROGDQ\FRRSHUDWLRQQHFHVVDU\IRUWKH'LVWULFW¶VGHYHORSPHQWRU FRQVWUXFWLRQRURSHUDWLRQRILPSURYHPHQWVRUSURYLVLRQRIVHUYLFHV & ([HUFLVHDQ\ OHJDOUHPHG\XQGHUWKHWHUPVRIDQ\ LQWHUJRYHUQPHQWDODJUHHPHQW XQGHUZKLFKWKH'LVWULFWLVLQGHIDXOWRU ' ([HUFLVHDQ\RWKHUOHJDODQGHTXLWDEOHUHPHG\DYDLODEOHXQGHUWKHODZLQFOXGLQJ VHHNLQJSURKLELWRU\DQGPDQGDWRU\LQMXQFWLYHUHOLHIDJDLQVWWKH'LVWULFWWRHQVXUHFRPSOLDQFHZLWK WKHSURYLVLRQVRIWKH6HUYLFH3ODQRUDSSOLFDEOHODZ XVIII. INTERGOVERNMENTAL AGREEMENT WITH CITY (DFKRIWKH'LVWULFWVDQGWKH&LW\VKDOOHQWHULQWRDQLQWHUJRYHUQPHQWDODJUHHPHQWWKHIRUP RI ZKLFK VKDOO EH LQ VXEVWDQWLDOO\ WKH IRUP DWWDFKHG KHUHWR DV Exhibit I DQG LQFRUSRUDWHG E\ UHIHUHQFH WKH³IGA´  $ EXHIBIT A-1 /(*$/'(6&5,37,212)',675,&712%281'$5,(6 )LHOG'DWH 3UHSDUHGIRU 3URMHFW 3URM0DQDJHU  'DWH 5HYLVLRQV 3DUW\&KLHI 6XUYH\7HFK :HVWWK6WUHHW /RYHODQG&RORUDGR 2IILFH,QIR#SOVFRUSRUDWLRQFRP 3/6&RUSRUDWLRQ 127,&($FFRUGLQJWR&RORUDGRODZ\RXPXVWFRPPHQFHDQ\OHJDO DFWLRQEDVHGXSRQDQ\GHIHFWLQWKLVVXUYH\ZLWKLQWKUHH\HDUVDIWHU\RX ILUVWGLVFRYHUVXFKGHIHFW,QQRHYHQWPD\DQ\DFWLRQEDVHGXSRQDQ\ GHIHFWLQWKLVVXUYH\EHFRPPHQFHGPRUHWKDQWHQ\HDUVIURPWKHGDWH RIWKHFHUWLILFDWLRQVKRZQKHUHRQ ' 1$ +LJKODQG'HYHORSPHQW6HUYLFHV,QF 1$ 0'* 0%6 see sheet 2 for exhibit sheet 1 of 2 $SRUWLRQRIWKH6RXWKHDVW RI6HFWLRQ7RZQVKLS1RUWK5DQJH:HVWRIWKHWK30&LW\RI)RUW&ROOLQV &RXQW\RI/DULPHU6WDWHRI&RORUDGR &RQVLGHULQJWKH(DVWOLQHRIWKH6RXWKHDVW RI6HFWLRQ7RZQVKLS1RUWK5DQJH:HVWRIWKHWK30DV EHDULQJ1ƒ (DQGZLWKDOOEHDULQJVFRQWDLQHGKHUHLQEHLQJUHODWLYHWKHUHWR &200(1&,1*DWWKH6RXWKHDVWFRUQHURI6HFWLRQ7RZQVKLS1RUWK5DQJH:HVWRIWKHWK30 WKHQFH1ƒ (IRUDGLVWDQFHRIIHHWDORQJWKH(DVWOLQHRIWKH6RXWKHDVW RIVDLG6HFWLRQ WKHQFH1ƒ :IRUDGLVWDQFHRIIHHWWRDSRLQWRQWKH:HVWHUO\ULJKWRIZD\OLQHRI1RUWK/HPD\$YHQXH WKHQFH1ƒ :IRUDGLVWDQFHRIIHHWWRWKH32,172)%(*,11,1*' WKHQFH1ƒ :IRUDGLVWDQFHRIIHHW WKHQFH1ƒ (IRUDGLVWDQFHRIIHHW WKHQFH6ƒ (IRUDGLVWDQFHRIIHHW WKHQFH6ƒ :IRUDGLVWDQFHRIIHHWWRWKH3RLQWRI%HJLQQLQJ' &RQWDLQLQJVTIWPRUHRUOHVV :ULWWHQE\0%U\DQ6KRUW&RORUDGR3/6 1ƒ : 32,172) %(*,11,1*' 6ƒ ( 1ƒ (   1ƒ :  6ƒ :  'LVWULFW “VTIW 32,172)&200(1&(0(17 6RXWKHDVW&RUQHURI6HFWLRQ 7RZQVKLS1RUWK5DQJH:HVW 1ƒ ( EDVLVRIEHDULQJV (DVWOLQHRIWKH6RXWKHDVW   RI6HFWLRQ  1ƒ : :HVWULJKWRIZD\OLQH 1RUWK/HPD\$YHQXH 1RUWK/HPD\$YHQXH (DVW &RUQHURI6HFWLRQ 7RZQVKLS1RUWK5DQJH:HVW )LHOG'DWH 3UHSDUHGIRU 3URMHFW 3URM0DQDJHU  'DWH 5HYLVLRQV 3DUW\&KLHI 6XUYH\7HFK :HVWWK6WUHHW /RYHODQG&RORUDGR 2IILFH,QIR#SOVFRUSRUDWLRQFRP 3/6&RUSRUDWLRQ 127,&($FFRUGLQJWR&RORUDGRODZ\RXPXVWFRPPHQFHDQ\OHJDO DFWLRQEDVHGXSRQDQ\GHIHFWLQWKLVVXUYH\ZLWKLQWKUHH\HDUVDIWHU\RX ILUVWGLVFRYHUVXFKGHIHFW,QQRHYHQWPD\DQ\DFWLRQEDVHGXSRQDQ\ GHIHFWLQWKLVVXUYH\EHFRPPHQFHGPRUHWKDQWHQ\HDUVIURPWKHGDWH RIWKHFHUWLILFDWLRQVKRZQKHUHRQ ' 1$ +LJKODQG'HYHORSPHQW6HUYLFHV,QF 1$ 0'* 0%6 6FDOHLQFK IHHW      see sheet 1 for description sheet 2 of 2  $ EXHIBIT A-2 /(*$/'(6&5,37,212)',675,&712%281'$5,(6 3?3URMHFW???GZJ?GB'GZJ0D\DP 2IILFH,QIR#SOVFRUSRUDWLRQFRP 3/6&RUSRUDWLRQ /RYHODQG&RORUDGR :HVWWK6WUHHW  'DWH 5HYLVLRQV 3DUW\&KLHI 6XUYH\7HFK 3URM0DQDJHU )LHOG'DWH 3UHSDUHGIRU 3URMHFW 127,&($FFRUGLQJWR&RORUDGRODZ\RXPXVWFRPPHQFHDQ\OHJDO DFWLRQEDVHGXSRQDQ\GHIHFWLQWKLVVXUYH\ZLWKLQWKUHH\HDUVDIWHU\RX ILUVWGLVFRYHUVXFKGHIHFW,QQRHYHQWPD\DQ\DFWLRQEDVHGXSRQDQ\ GHIHFWLQWKLVVXUYH\EHFRPPHQFHGPRUHWKDQWHQ\HDUVIURPWKHGDWH RIWKHFHUWLILFDWLRQVKRZQKHUHRQ 'HVFULSWLRQ([KLELW 0%6 0'* 1$ 1$ +LJKODQG'HYHORSPHQW6HUYLFHV,QF ' see sheet 2 for exhibit sheet 1 of 2 $SRUWLRQRIWKH6RXWKHDVW RI6HFWLRQ7RZQVKLS1RUWK5DQJH:HVWRIWKHWK30&LW\RI)RUW&ROOLQV &RXQW\RI/DULPHU6WDWHRI&RORUDGR &RQVLGHULQJWKH(DVWOLQHRIWKH6RXWKHDVW RI6HFWLRQ7RZQVKLS1RUWK5DQJH:HVWRIWKHWK30DV EHDULQJ1ƒ (DQGZLWKDOOEHDULQJVFRQWDLQHGKHUHLQEHLQJUHODWLYHWKHUHWR &200(1&,1*DWWKH6RXWKHDVWFRUQHURI6HFWLRQ7RZQVKLS1RUWK5DQJH:HVWRIWKHWK30 WKHQFH1ƒ (IRUDGLVWDQFHRIIHHWDORQJWKH(DVWOLQHRIWKH6RXWKHDVW RIVDLG6HFWLRQ WKHQFH1ƒ :IRUDGLVWDQFHRIIHHWWRDSRLQWRQWKH:HVWHUO\ULJKWRIZD\OLQHRI1RUWK/HPD\$YHQXHWR WKH32,172)%(*,11,1*VDLGSRLQWDOVREHLQJ3RLQW$ WKHQFH1ƒ :IRUDGLVWDQFHRIIHHWWRDSRLQWRIDWDQJHQWFXUYHFRQFDYHWRWKH1RUWKKDYLQJDUDGLXV RIIHHWDFKRUGEHDULQJRI1ƒ :DQGDFKRUGOHQJWKRIIHHW WKHQFH:HVWHUO\DORQJWKHDUFRIVDLGFXUYHIRUDGLVWDQFHRIIHHWWKURXJKDFHQWUDODQJOHRIƒ WRDSRLQW RIWDQJHQF\ WKHQFH1ƒ :IRUDGLVWDQFHRIIHHWWRWKHDSSUR[LPDWHFHQWHUOLQHRI/DNH&DQDO'LWFK WKHQFH1ƒ (IRUDGLVWDQFHRIIHHWDORQJVDLGGLWFKFHQWHUOLQH WKHQFH6ƒ (IRUDGLVWDQFHRIIHHWWRDSRLQWRIDQRQWDQJHQWFXUYHFRQFDYHWRWKH6RXWKHDVWKDYLQJD UDGLXVRIIHHWDFKRUGEHDULQJ1ƒ (DQGDFKRUGOHQJWKRIIHHW WKHQFH1RUWKHDVWHUO\DORQJWKHDUFRIVDLGFXUYHIRUDGLVWDQFHRIIHHWWKURXJKDFHQWUDODQJOHRIƒ WRD SRLQWRIQRQWDQJHQF\ WKHQFH1ƒ (IRUDGLVWDQFHRIIHHWWRDSRLQWRIDQRQWDQJHQWFXUYHFRQFDYHWRWKH6RXWKKDYLQJD UDGLXVRIIHHWDFKRUGEHDULQJ1ƒ (DQGDFKRUGOHQJWKRIIHHW WKHQFH(DVWHUO\DORQJWKHDUFRIVDLGFXUYHIRUDGLVWDQFHRIIHHWWKURXJKDFHQWUDODQJOHRIƒ 1ƒ :  32,172)%(*,11,1*' 32,172)&200(1&(0(17 3RLQW$ 1ƒ : 1ƒ : 1ƒ ( / & / & / 6ƒ : 1ƒ : & / :HVWULJKWRIZD\OLQH 1RUWK/HPD\$YHQXH 'LVWULFW “DFUHV see Detail this sheet DSSUR[LPDWHFHQWHUOLQHRI /DNH&DQDO'LWFK 1RUWK/HPD\$YHQXH 32,172)&200(1&(0(17 6RXWKHDVW&RUQHURI6HFWLRQ 7RZQVKLS1RUWK5DQJH:HVW  1ƒ ( EDVLVRIEHDULQJV (DVWOLQHRIWKH 6RXWKHDVW   RI 6HFWLRQ /LQH7DEOH /LQH / / / / / / / / / / / / /HQJWK  $ EXHIBIT A-3 /(*$/'(6&5,37,212)',675,&712%281'$5,(6 3?3URMHFW???GZJ?GB'GZJ0D\DP 2IILFH,QIR#SOVFRUSRUDWLRQFRP 3/6&RUSRUDWLRQ /RYHODQG&RORUDGR :HVWWK6WUHHW  'DWH 5HYLVLRQV 3DUW\&KLHI 6XUYH\7HFK 3URM0DQDJHU )LHOG'DWH 3UHSDUHGIRU 3URMHFW 127,&($FFRUGLQJWR&RORUDGRODZ\RXPXVWFRPPHQFHDQ\OHJDO DFWLRQEDVHGXSRQDQ\GHIHFWLQWKLVVXUYH\ZLWKLQWKUHH\HDUVDIWHU\RX ILUVWGLVFRYHUVXFKGHIHFW,QQRHYHQWPD\DQ\DFWLRQEDVHGXSRQDQ\ GHIHFWLQWKLVVXUYH\EHFRPPHQFHGPRUHWKDQWHQ\HDUVIURPWKHGDWH RIWKHFHUWLILFDWLRQVKRZQKHUHRQ 'HVFULSWLRQ([KLELW 0%6 0'* 1$ 1$ +LJKODQG'HYHORSPHQW6HUYLFHV,QF ' $SRUWLRQRIWKH6RXWKHDVW RI6HFWLRQ7RZQVKLS1RUWK5DQJH:HVWRIWKHWK30&LW\RI)RUW&ROOLQV &RXQW\RI/DULPHU6WDWHRI&RORUDGR &RQVLGHULQJWKH(DVWOLQHRIWKH6RXWKHDVW RI6HFWLRQ7RZQVKLS1RUWK5DQJH:HVWRIWKHWK30DV EHDULQJ1ƒ (DQGZLWKDOOEHDULQJVFRQWDLQHGKHUHLQEHLQJUHODWLYHWKHUHWR &200(1&,1*DWWKH6RXWKHDVWFRUQHURI6HFWLRQ7RZQVKLS1RUWK5DQJH:HVWRIWKHWK30 WKHQFH1ƒ (IRUDGLVWDQFHRIIHHWDORQJWKH(DVWOLQHRIWKH6RXWKHDVW RIVDLG6HFWLRQ WKHQFH1ƒ :IRUDGLVWDQFHRIIHHWWRDSRLQWRQWKH:HVWHUO\ULJKWRIZD\OLQHRI1RUWK/HPD\$YHQXHWR WKH32,172)%(*,11,1*VDLGSRLQWDOVREHLQJ3RLQW$ WKHQFH1ƒ :IRUDGLVWDQFHRIIHHWWRDSRLQWRIDWDQJHQWFXUYHFRQFDYHWRWKH1RUWKKDYLQJDUDGLXV RIIHHWDFKRUGEHDULQJRI1ƒ :DQGDFKRUGOHQJWKRIIHHW WKHQFH:HVWHUO\DORQJWKHDUFRIVDLGFXUYHIRUDGLVWDQFHRIIHHWWKURXJKDFHQWUDODQJOHRIƒ WRDSRLQW RIWDQJHQF\ WKHQFH1ƒ :IRUDGLVWDQFHRIIHHWWRWKHDSSUR[LPDWHFHQWHUOLQHRI/DNH&DQDO'LWFK WKHQFH6ƒ :IRUDGLVWDQFHRIIHHWDORQJVDLGGLWFKFHQWHUOLQH WKHQFH6ƒ :IRUDGLVWDQFHRIIHHWDORQJVDLGGLWFKFHQWHUOLQH WKHQFH6ƒ :IRUDGLVWDQFHRIIHHWDORQJVDLGGLWFKFHQWHUOLQH WKHQFH6ƒ (IRUDGLVWDQFHRIIHHWWRWKH:HVWOLQHRIWKH$/7$9,67$68%',9,6,21SXEOLFUHFRUGV &RXQW\RI/DULPHU6WDWHRI&RORUDGR WKHQFH1ƒ (IRUDGLVWDQFHRIIHHWDORQJVDLG:HVWOLQHWRWKH1RUWKOLQHRIVDLG$/7$9,67$ 68%',9,6,21 WKHQFH6ƒ (IRUDGLVWDQFHRIIHHWDORQJVDLG1RUWKOLQHWRWKH(DVWOLQHRIVDLG$/7$9,67$ 68%',9,6,21 WKHQFH6ƒ 1ƒ :  32,172)%(*,11,1* 32,172)&200(1&(0(17 3RLQW$ see Detail this sheet 1ƒ : 5  /  ƒ  &K  &% 1ƒ : 1ƒ : 6ƒ :   6ƒ :  6ƒ :  6ƒ ( 1ƒ (  6ƒ ( 6ƒ :  6ƒ (  1ƒ (  1RUWK/HPD\$YHQXH 1ƒ : 'LVWULFW “DFUHV DSSUR[LPDWHFHQWHUOLQHRI /DNH&DQDO'LWFK :HVWULJKWRIZD\OLQH 1RUWK/HPD\$YHQXH :HVWOLQHRI $/7$9,67$68%',9,6,21 1RUWKOLQHRI $/7$9,67$68%',9,6,21 (DVWOLQHRI $/7$9,67$ 68%',9,6,21 32,172)&200(1&(0(17  % EXHIBIT B-1 ',675,&712%281'$5<0$3 /$.(&$1$/ 1/(0$<$9(18( (681,*$52$' 1 :( 6 /(*(1' 1257+),(/'0(752',675,&7%281'$5< ',675,&7 64)7 $& '5$:1%< '$7( 6&$/( + +'6352- 6+((7 2) 1257+),(/' ',675,&7$5($%281'$5<0$3    .5%  %   6&$/(      ',675,&7(1/$5*(0(17 6&$/(   % EXHIBIT B-2 ',675,&712%281'$5<0$3 /$.(&$1$/ ',675,&7 64)7 $& 1/(0$<$9(18( (681,*$52$' 1 :( 6 /(*(1' 1257+),(/'0(752',675,&7%281'$5< '5$:1%< '$7( 6&$/( + +'6352- 6+((7 2) 1257+),(/' ',675,&7$5($%281'$5<0$3    .5%  %   6&$/(       % EXHIBIT B-3 ',675,&712%281'$5<0$3 /$.(&$1$/ ',675,&7 64)7 $& 1/(0$<$9(18( (681,*$52$' 1 :( 6 /(*(1' 1257+),(/'0(752',675,&7%281'$5< '5$:1%< '$7( 6&$/( + +'6352- 6+((7 2) 1257+),(/' ',675,&7$5($%281'$5<0$3    .5%  %   6&$/(      ',675,&7 64)7 $& ',675,&7(1/$5*(0(17 6&$/(  & EXHIBIT C 9,&,1,7<0$3 352326('1257+),(/' 0(752',675,&7 1 : ( 6 '5$:1%< '$7( 6&$/( + +'6352- 6+((7 2) 1257+),(/' 9,&,1,7<0$3    .5%  (;+,%,7&    6&$/(    ' EXHIBIT D 38%/,&,03529(0(17&267(67,0$7(6 ^ƵŵŵĂƌLJƐƚŝŵĂƚĞŽĨWƌĞůŝŵŝŶĂƌLJŝƐƚƌŝĐƚdžƉĞŶĚŝƚƵƌĞƐ ĞƐŝŐŶŶŐŝŶĞĞƌ͗ <͘ƌŝŐŵĂŶ ĞƐŝŐŶ&ŝƌŵ͗ ,ŝŐŚůĂŶĚĞǀĞůŽƉŵĞŶƚ^ĞƌǀŝĐĞƐ WƌŽũĞĐƚEƵŵďĞƌ͗ ϭϴͲϭϬϬϬͲϬϬ ĂƚĞ͗ ƵŐƵƐƚϮϯ͕ϮϬϭϵ EŽ͘ YƵĂŶƚŝƚLJ hŶŝƚƐ hŶŝƚŽƐƚ dŽƚĂů ϭ Ϭ͘ϴϬϱ >^ Ψ ϭ͕ϱϬϬ͕ϬϬϬ͘ϬϬ Ψ ϭ͕ϮϬϳ͕ϱϬϬ͘ϬϬ ůĞĂƌŝŶŐ͕'ƌƵďďŝŶŐ͕ĂŶĚdŽƉƐŽŝů^ƚƌŝƉƉŝŶŐ ϰϱ  Ψ ϭϮ͕ϬϬϬ͘ϬϬ Ψ  ϱϰϬ͕ϵϲϬ͘ϬϬ ϮϬϭ͕ϮϱϬ z Ψ ϲ͘ϬϬ Ψ ϭ͕ϮϬϳ͕ϱϬϬ͘ϬϬ /ŵƉŽƌƚ&ŝůůŝƌƚ ϭϲϭ͕ϬϬϬ z Ψ ϭϱ͘ϬϬ ΨϮ͕ϰϭϱ͕ϬϬϬ͘ϬϬ Ϭ͘ϴϬϱ >^ Ψ Ϯϱ͕ϬϬϬ͘ϬϬ Ψ  ϮϬ͕ϭϮϱ͘ϬϬ Ψ ϱ͕ϯϵϭ͕Ϭϴϱ͘ϬϬ Ϯ DĞƚƌŽŝƐƚƌŝĐƚKǁŶĞĚƌŝǀĞƐ;ϮϰΖ^ĞĐƚŝŽŶͿ >& Ψ ϮϬϱ͘ϬϬ Ψ  Ͳ >& Ψ ϮϮϱ͘ϬϬ Ψ  Ͳ ϰ͕Ϯϲϰ >& Ψ ϰϯϬ͘ϬϬ Ψ ϭ͕ϴϯϯ͕ϱϮϬ͘ϬϬ ŽŶŶĞĐƚŽƌ>ŽĐĂů^ƚƌĞĞƚǁŝƚŚDĞĚŝĂŶ;ϲϱΖ^ĞĐƚŝŽŶͿ ϰϱϬ >& Ψ ϱϱϬ͘ϬϬ Ψ  Ϯϰϳ͕ϱϬϬ͘ϬϬ Ϯ͕ϭϲϬ >& Ψ ϯϰϲ͘ϬϬ Ψ  ϳϰϳ͕ϯϲϬ͘ϬϬ KŶͲ^ŝƚĞ^ƵŶŝŐĂZĚϰͲůĂŶĞƌƚĞƌŝĂůhƉƐŝnjŝŶŐ;ϴϯΖ^ĞĐƚŝŽŶͿ >& Ψ ϳϳϵ͘ϬϬ Ψ  Ͳ >& Ψ ϳϭϱ͘ϬϬ Ψ  Ͳ ϭ >^ Ψ ϮϱϬ͕ϬϬϬ͘ϬϬ Ψ  ϮϱϬ͕ϬϬϬ͘ϬϬ ^ŝŐŶĂŐĞĂŶĚ^ƚƌŝƉŝŶŐ ϭ >^ Ψ Ϯϱ͕ϬϬϬ͘ϬϬ Ψ  Ϯϱ͕ϬϬϬ͘ϬϬ Ψ ϯ͕ϭϬϯ͕ϯϴϬ͘ϬϬ ϯ Ϯ͕ϮϲϬ >& Ψ ϱϬ͘ϬϬ Ψ  ϭϭϯ͕ϬϬϬ͘ϬϬ ϴΗtĂƚĞƌůŝŶĞ ϳ͕ϳϲϬ >& Ψ ϲϱ͘ϬϬ Ψ  ϱϬϰ͕ϰϬϬ͘ϬϬ Ͳ >& Ψ ϴϱ͘ϬϬ Ͳ Ͳ >& Ψ ϭϬϬ͘ϬϬ Ͳ Ͳ >& Ψ Ϯ͕ϬϬϬ͘ϬϬ Ͳ Ͳ>^ Ψ  Ͳ Ͳ Ψ  ϲϭϳ͕ϰϬϬ͘ϬϬ ϰ ϲ͕ϯϱϲ >& Ψ ϵϬ͘ϬϬ Ψ  ϱϳϮ͕ϬϰϬ͘ϬϬ ϭ͕ϰϴϰ >& Ψ ϭϬϬ͘ϬϬ Ψ  ϭϰϴ͕ϰϬϬ͘ϬϬ ϭϮΗ^ĂŶŝƚĂƌLJ^ĞǁĞƌ Ͳ >& Ψ ϭϭϮ͘ϬϬ Ͳ ϴΗ^ƵďĚƌĂŝŶ Ͳ >& Ψ ϳϱ͘ϬϬ Ͳ džŝƐƚŝŶŐϭϱΗƚŽϭϴΗ^ĂŶŝƚĂƌLJ^ĞǁĞƌhƉƐŝnjĞ >& Ψ ϭϱϬ͘ϬϬ Ψ  Ͳ >& Ψ ϭϴϬ͘ϬϬ Ψ  Ͳ Ψ  ϳϮϬ͕ϰϰϬ͘ϬϬ ϱ ϳ͕ϴϵϬ >& Ψ ϭϵϬ͘ϬϬ Ψ ϭ͕ϰϵϵ͕ϭϬϬ͘ϬϬ KƵƚůĞƚͬŽŶƚƌŽů^ƚƌƵĐƚƵƌĞ ϵ  Ψ ϭϬ͕ϬϬϬ͘ϬϬ Ψ  ϵϬ͕ϬϬϬ͘ϬϬ >//ŶĨŝůƚƌĂƚŝŽŶ'ĂůůĞƌŝĞƐ ϯ  Ψ ϭϬϬ͕ϬϬϬ͘ϬϬ Ψ  ϯϬϬ͕ϬϬϬ͘ϬϬ Ψ ϭ͕ϴϴϵ͕ϭϬϬ͘ϬϬ ^ƵďƚŽƚĂů ^ƵďƚŽƚĂů ^ĂŶŝƚĂƌLJ^ĞǁĞƌ/ŵƉƌŽǀĞŵĞŶƚƐ ϴΗ^ĂŶŝƚĂƌLJ^ĞǁĞƌ ZW^ƚŽƌŵ^ĞǁĞƌ ^ƵďƚŽƚĂů ϭϬΗ^ĂŶŝƚĂƌLJ^ĞǁĞƌ ϭϬΗtĂƚĞƌůŝŶĞ KŶͲ^ŝƚĞ^ƵŶŝŐĂZĚϮͲůĂŶĞŽŶŶĞĐƚŽƌǁͬDĞĚŝĂŶ;ϲϱΖ^ĞĐƚŝŽŶͿ ^ƚŽƌŵƌĂŝŶĂŐĞ/ŵƉƌŽǀĞŵĞŶƚƐ ϭϮΗtĂƚĞƌůŝŶĞ hƚŝůŝƚLJŽƌŝŶŐƐ ZĂǁtĂƚĞƌZĞƋƵŝƌĞŵĞŶƚƐ džŝƐƚŝŶŐϭϴΗƚŽϮϰΗ^ĂŶŝƚĂƌLJ^ĞǁĞƌhƉƐŝnjĞ WŽƚĂďůĞtĂƚĞƌůŝŶĞ/ŵƉƌŽǀĞŵĞŶƚƐ ϲ  Ψ  Ͳ >ĂŶĚƐĐĂƉĞĚKƉĞŶ^ƉĂĐĞ ϴ͘ϱ  Ψ ϭϭϬ͕ϬϬϬ͘ϬϬ Ψ  ϵϯϱ͕ϬϬϬ͘ϬϬ ^& Ψ ϭϱ͘ϬϬ Ψ  Ͳ ϭ >^ Ψ ϳϱ͕ϬϬϬ͘ϬϬ Ψ  ϳϱ͕ϬϬϬ͘ϬϬ >^ Ψ ϭϮϱ͕ϬϬϬ͘ϬϬ Ͳ ůƵƵƐĞͬWŽŽů >^ Ψ Ϯ͕ϬϬϬ͕ϬϬϬ͘ϬϬ Ψ  Ͳ Ψ ϭ͕ϬϭϬ͕ϬϬϬ͘ϬϬ ϳ ϭ >^ Ψ ϭ͕Ϯϳϰ͕ϬϬϬ͘ϬϬ Ψ ϭ͕Ϯϳϰ͕ϬϬϬ͘ϬϬ ŽŶƐƚƌƵĐƚŝŽŶDĂŶĂŐĞŵĞŶƚͬ/ŶƐƉĞĐƚŝŽŶͬdĞƐƚŝŶŐ ϭ >^ Ψ ϭ͕ϵϭϬ͕ϬϬϬ͘ϬϬ Ψ ϭ͕ϵϭϬ͕ϬϬϬ͘ϬϬ ϭ >^ Ψ ϯϴϮ͕ϬϬϬ͘ϬϬ Ψ  ϯϴϮ͕ϬϬϬ͘ϬϬ Ψ ϯ͕ϱϲϲ͕ϬϬϬ͘ϬϬ Ψ ϭϲ͕Ϯϵϳ͕ϰϬϱ͘ϬϬ ŽŶƚŝŶŐĞŶĐLJ;ϮϬйͿ Ψ ϯ͕Ϯϱϵ͕ϰϴϱ͘ϬϬ dŽƚĂůŽƐƚ Ψ ϭϵ͕ϱϱϲ͕ϴϵϬ͘ϬϬ ^ƵďƚŽƚĂů ůƚĂsŝƐƚĂ^ƵďĚŝǀŝƐŝŽŶƵĨĨĞƌƌĞĂ DŽŶƵŵĞŶƚ^ŝŐŶƐ ZĞŐŝŽŶĂůdƌĂŝůƐ ŶŐŝŶĞĞƌŝŶŐͬ^ƵƌǀĞLJŝŶŐ ĚŵŝŶͬ͘WůĂŶŶŝŶŐͬWĞƌŵŝƚƚŝŶŐ EĂƚƵƌĂůƌĞĂKƉĞŶ^ƉĂĐĞ ^ƵďƚŽƚĂů ĚŵŝŶͬ͘ĞƐŝŐŶͬWĞƌŵŝƚƚŝŶŐͬƚĐ͘ KƉĞŶ^ƉĂĐĞ͕WĂƌŬƐ͕ĂŶĚdƌĂŝůƐ /ŶĨƌĂƐƚƌƵĐƚƵƌĞ^ƵďƚŽƚĂů ^ƵŵŵĂƌLJƐƚŝŵĂƚĞŽĨWƌĞůŝŵŝŶĂƌLJŝƐƚƌŝĐƚdžƉĞŶĚŝƚƵƌĞƐ ĞƐŝŐŶŶŐŝŶĞĞƌ͗ <͘ƌŝŐŵĂŶ ĞƐŝŐŶ&ŝƌŵ͗ ,ŝŐŚůĂŶĚĞǀĞůŽƉŵĞŶƚ^ĞƌǀŝĐĞƐ WƌŽũĞĐƚEƵŵďĞƌ͗ ϭϴͲϭϬϬϬͲϬϬ ĂƚĞ͗ ƵŐƵƐƚϮϯ͕ϮϬϭϵ EŽ͘ YƵĂŶƚŝƚLJ hŶŝƚƐ hŶŝƚŽƐƚ dŽƚĂů ϭ >^ Ψ ϭ͕ϱϬϬ͕ϬϬϬ͘ϬϬ Ψ Ͳ ůĞĂƌŝŶŐ͕'ƌƵďďŝŶŐ͕ĂŶĚdŽƉƐŽŝů^ƚƌŝƉƉŝŶŐ  Ψ ϭϮ͕ϬϬϬ͘ϬϬ Ψ Ͳ z Ψ ϲ͘ϬϬ Ψ Ͳ /ŵƉŽƌƚ&ŝůů z Ψ ϭϱ͘ϬϬ Ψ Ͳ >^ Ψ Ϯϱ͕ϬϬϬ͘ϬϬ Ψ Ͳ Ψ Ͳ Ϯ DĞƚƌŽŝƐƚƌŝĐƚKǁŶĞĚƌŝǀĞƐ;ϮϰΖ^ĞĐƚŝŽŶͿ ϯ͕ϵϲϬ >& Ψ ϭϭϮ͘ϬϬ Ψ ϰϰϯ͕ϱϮϬ͘ϬϬ Ϯ͕ϴϴϬ >& Ψ ϭϯϭ͘ϬϬ Ψ ϯϳϳ͕ϮϴϬ͘ϬϬ >& Ψ ϰϯϬ͘ϬϬ Ψ Ͳ ŽŶŶĞĐƚŽƌ>ŽĐĂů^ƚƌĞĞƚǁŝƚŚDĞĚŝĂŶ;ϲϱΖ^ĞĐƚŝŽŶͿ >& Ψ ϱϱϬ͘ϬϬ Ψ Ͳ >& Ψ ϯϰϲ͘ϬϬ Ψ Ͳ KŶͲ^ŝƚĞ^ƵŶŝŐĂZĚϰͲůĂŶĞƌƚĞƌŝĂůhƉƐŝnjŝŶŐ;ϴϯΖ^ĞĐƚŝŽŶͿ Ϯ͕ϭϲϬ >& Ψ ϳϳϵ͘ϬϬ Ψ ϭ͕ϲϴϮ͕ϲϰϬ͘ϬϬ ϱϮϬ >& Ψ ϭ͕ϰϵϬ͘ϬϬ Ψ ϳϳϰ͕ϴϬϬ͘ϬϬ >^ Ψ ϮϱϬ͕ϬϬϬ͘ϬϬ Ψ Ͳ ^ŝŐŶĂŐĞĂŶĚ^ƚƌŝƉŝŶŐ >^ Ψ Ϯϱ͕ϬϬϬ͘ϬϬ Ψ Ͳ Ψ ϯ͕Ϯϳϴ͕ϮϰϬ͘ϬϬ ϯ >& Ψ ϱϬ͘ϬϬ Ψ Ͳ ϴΗtĂƚĞƌůŝŶĞ >& Ψ ϲϱ͘ϬϬ Ψ Ͳ Ͳ >& Ψ ϴϱ͘ϬϬ Ͳ Ͳ >& Ψ ϭϬϬ͘ϬϬ Ͳ Ͳ >& Ψ Ϯ͕ϬϬϬ͘ϬϬ Ͳ Ͳ>^ Ψ Ͳ Ͳ Ψ Ͳ ϰ >& Ψ ϵϬ͘ϬϬ Ψ Ͳ >& Ψ ϭϬϬ͘ϬϬ Ψ Ͳ ϭϮΗ^ĂŶŝƚĂƌLJ^ĞǁĞƌ Ͳ >& Ψ ϭϭϮ͘ϬϬ Ͳ ϴΗ^ƵďĚƌĂŝŶ Ͳ >& Ψ ϳϱ͘ϬϬ Ͳ džŝƐƚŝŶŐϭϱΗƚŽϭϴΗ^ĂŶŝƚĂƌLJ^ĞǁĞƌhƉƐŝnjĞ ϱϲϱ >& Ψ ϭϳϲ͘ϬϬ Ψ ϵϵ͕ϰϰϬ͘ϬϬ Ϯ͕ϭϯϬ >& Ψ ϮϬϲ͘ϬϬ Ψ ϰϯϴ͕ϳϴϬ͘ϬϬ Ͳ>^ Ͳ Ψ ϱϯϴ͕ϮϮϬ͘ϬϬ ϱ >& Ψ ϭϵϬ͘ϬϬ Ψ Ͳ KƵƚůĞƚͬŽŶƚƌŽů^ƚƌƵĐƚƵƌĞ  Ψ ϭϬ͕ϬϬϬ͘ϬϬ Ψ Ͳ >//ŶĨŝůƚƌĂƚŝŽŶ'ĂůůĞƌŝĞƐ  Ψ ϭϬϬ͕ϬϬϬ͘ϬϬ Ψ Ͳ Ψ Ͳ 'ƌĂĚŝŶŐͬDŝƐĐĞůůĂŶĞŽƵƐ KŶͲ^ŝƚĞ^ƵŶŝŐĂZĚϮͲůĂŶĞŽŶŶĞĐƚŽƌǁͬDĞĚŝĂŶ;ϲϱΖ^ĞĐƚŝŽŶͿ EKEͲ^/Wh>//DWZKsDEdK^d^&KZEKZd,&/>DdZK/^dZ/dEK^͘ϭͲϯ dŚĞƵŶŝƚƐĂŶĚĐŽƐƚďĞůŽǁĂƌĞďĞƐƚĂƐƐƵŵƉƚŝŽŶƐďĂƐĞĚŽŶƚŚĞůĞǀĞůŽĨŝŶĨŽƌŵĂƚŝŽŶĂǀĂŝůĂďůĞĂƚƚŚŝƐƚŝŵĞŝŶĚĞƐŝŐŶ͘^ƚƌĞĞƚƐĞĐƚŝŽŶŝŶƌĞĨĞƌĞŶĐĞƚŽ>h^^ ŽŶŶĞĐƚŽƌ>ŽĐĂůƐƚƌĞĞƚƐĞĐƚŝŽŶ͕ĂŶĚƉĂǀĞŵĞŶƚƐĞĐƚŝŽŶŝŶƌĞĨĞƌĞŶĐĞƚŽŐĞŽƚĞĐŚƌĞƉŽƌƚ WƵďůŝĐ/ŵƉƌŽǀĞŵĞŶƚƐ ĞƐĐƌŝƉƚŝŽŶ WŽƚĂďůĞtĂƚĞƌůŝŶĞ/ŵƉƌŽǀĞŵĞŶƚƐ DŽďŝůŝnjĂƚŝŽŶͬ'ĞŶĞƌĂůŽŶĚŝƚŝŽŶƐ ĂƌƚŚǁŽƌŬ;ĐƵƚͬĨŝůůͬƉůĂĐĞͿ ƌŽƐŝŽŶŽŶƚƌŽůͬdƌĂĨĨŝĐŽŶƚƌŽů ^ƵďƚŽƚĂů ZŽĂĚǁĂLJ/ŵƉƌŽǀĞŵĞŶƚƐ DĞƚƌŽŝƐƚƌŝĐƚKǁŶĞĚƌŝǀĞƐ;ϮϲΖ^ĞĐƚŝŽŶͿ ϲ Ͳ Ψ Ͳ >ĂŶĚƐĐĂƉĞĚKƉĞŶ^ƉĂĐĞ ϲ͘ϲ  Ψ ϭϭϬ͕ϬϬϬ͘ϬϬ Ψ ϳϮϯ͕ϴϬϬ͘ϬϬ ϭϯ͕ϮϳϬ ^& Ψ ϭϱ͘ϬϬ Ψ ϭϵϵ͕ϬϱϬ͘ϬϬ >^ Ψ ϳϱ͕ϬϬϬ͘ϬϬ Ψ Ͳ ϭ >^ Ψ ϭϮϱ͕ϬϬϬ͘ϬϬ Ψ ϭϮϱ͕ϬϬϬ͘ϬϬ ϭ >^ Ψ Ϯ͕ϬϬϬ͕ϬϬϬ͘ϬϬ Ψ Ϯ͕ϬϬϬ͕ϬϬϬ͘ϬϬ Ψ ϯ͕Ϭϰϳ͕ϴϱϬ͘ϬϬ ϳ ϭ >^ Ψ ϲϴϳ͕ϬϬϬ͘ϬϬ Ψ ϲϴϳ͕ϬϬϬ͘ϬϬ ŽŶƐƚƌƵĐƚŝŽŶDĂŶĂŐĞŵĞŶƚͬ/ŶƐƉĞĐƚŝŽŶͬdĞƐƚŝŶŐ ϭ >^ Ψ ϭ͕ϬϯϬ͕ϬϬϬ͘ϬϬ Ψ ϭ͕ϬϯϬ͕ϬϬϬ͘ϬϬ ϭ >^ Ψ ϮϬϲ͕ϬϬϬ͘ϬϬ Ψ ϮϬϲ͕ϬϬϬ͘ϬϬ Ψ ϭ͕ϵϮϯ͕ϬϬϬ͘ϬϬ Ψ ϴ͕ϳϴϳ͕ϯϭϬ͘ϬϬ ŽŶƚŝŶŐĞŶĐLJ;ϮϬйͿ Ψ ϭ͕ϳϱϳ͕ϰϲϱ͘ϬϬ dŽƚĂůŽƐƚ Ψ ϭϬ͕ϱϰϰ͕ϳϳϱ͘ϬϬ KƉĞŶ^ƉĂĐĞ͕WĂƌŬƐ͕ĂŶĚdƌĂŝůƐ EĂƚƵƌĂůƌĞĂKƉĞŶ^ƉĂĐĞ ^ƵďƚŽƚĂů /ŶĨƌĂƐƚƌƵĐƚƵƌĞ^ƵďƚŽƚĂů DŽŶƵŵĞŶƚ^ŝŐŶƐ ůƚĂsŝƐƚĂ^ƵďĚŝǀŝƐŝŽŶƵĨĨĞƌƌĞĂ ^ƵďƚŽƚĂů ĚŵŝŶͬ͘ĞƐŝŐŶͬWĞƌŵŝƚƚŝŶŐͬƚĐ͘ ŶŐŝŶĞĞƌŝŶŐͬ^ƵƌǀĞLJŝŶŐ ĚŵŝŶͬ͘WůĂŶŶŝŶŐͬWĞƌŵŝƚƚŝŶŐ ůƵƵƐĞͬWŽŽů ZĞŐŝŽŶĂůdƌĂŝůƐ ( EXHIBIT E 38%/,&,03529(0(170$36 1/(0$<$9(18( (681,*$52$' /(*(1' &2//(&725/2&$/675((76  :,'(38%/,&5,*+72):$< 1257+),(/'0(752',675,&7%281'$5< /$1($57(5,$/  :,'(38%/,&5,*+72):$< &2//(&725/2&$/675((7:,7+0(',$1  :,'(38%/,&5,*+72):$< 1 :( 6 '5$:1%< '$7( 6&$/( + +'6352- 6+((7 2) 1257+),(/' 675((760$3    .5%  (   6&$/(      35,9$7('5,9(6  :,'(6(&7,21 35,9$7('5,9(6  :,'(6(&7,21 1/(0$<$9(18( (681,*$52$' /$.(&$1$/ /(*(1' :$7(5/,1(39& $//:$7(52:1('$1'0$,17$,1(' %<)257&2//,1687,/,7,(6 1257+),(/'0(752',675,&7%281'$5< 1 :( 6 '5$:1%< '$7( 6&$/( + +'6352- 6+((7 2) 1257+),(/' 327$%/(:$7(50$3    .5%  (   6&$/(     (;,67,1*:$7(5/,1( 6,=($6/$%(/('  1/(0$<$9(18( (681,*$52$' /$.(&$1$/ /(*(1' 6(:(5/,1(39& $//6(:(52:1('$1'0$,17$,1(' %<)257&2//,1687,/,7,(6 1257+),(/'0(752',675,&7%281'$5< (;,67,1*6(:(5/,1( 6,=($6/$%(/(' 6(:(5/,1(39& $//6(:(52:1('$1'0$,17$,1(' %<)257&2//,1687,/,7,(6 1 :( 6 '5$:1%< '$7( 6&$/( + +'6352- 6+((7 2) 1257+),(/' 6$1,7$5<6(:(50$3    .5%  (   6&$/(      /$.(&$1$/ 1/(0$<$9(18( (681,*$52$' /(*(1' 5&367250'5$,1/,1( 6,=(672%( '(7(50,1('$7),1$/'(6,*1 1257+),(/'0(752',675,&7%281'$5< (;,67,1*67250'5$,1/,1( '(7(17,21$5($6 /2:,03$&7'(9(/230(17 /,' /$.(&$1$/ 1/(0$<$9(18( (681,*$52$' /(*(1' &211(&7,9,7</$1'6&$3,1*:,7+75$,/6 1257+),(/'0(752',675,&7%281'$5< 675((76:,7+75((/$:1$5($6 /$1'6&$3('23(163$&( 1 :( 6 '5$:1%< '$7( 6&$/( + +'6352- 6+((7 2) 1257+),(/' 23(163$&(3$5.6 75$,/60$3    .5%  (   6&$/(      ) EXHIBIT F ),1$1&,$/3/$1 NORTHFIELD METROPOLITAN DISTRICT 1 Development Projection at 40.000 (target) Mills for Debt Service -- Service Plan 2050 Series 2030, G.O. Bonds, Pay & Cancel Refg of (proposed) Series 2020 + New Money, Assumes Investment Grade, 100x, 30-yr. Maturity 2049 0 < < < < < < < < Residential > > > > > > > > < Platted/Developed Lots > < < < < < < < < < < Commercial > > > > > > > > > > Mkt Value As'ed Value As'ed Value Mkt Value As'ed Value District District District Biennial @ 7.20% @ 29.00% Biennial @ 29.00% Total D/S Mill Levy D/S Mill Levy S.O. Taxes Total Total Reasses'mt Cumulative of Market Cumulative of Market Total Comm'l Reasses'mt Cumulative of Market Assessed [40.000 Target] Collections Collected Available YEAR Res'l Units @ 6.0% Market Value (2-yr lag) Market Value (2-yr lag) Sq. Ft. @ 6.0% Market Value (2-yr lag) Value [40.000 Cap] @ 98% @ 6% Revenue                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           BBBBBB BBBBBBBBBB BBBBBBBBBB BBBBBBBBBB BBBBBBBBBB BBBBBBBBBB BBBBBBBBBB        &10')LQ3ODQ 1563)LQ3ODQ,*5HIJ 3UHSDUHGE\'$'DYLGVRQ &R 'UDIW)RUGLVFXVVLRQSXUSRVHVRQO\ 1 1 2050 2049 0 YEAR                                            NORTHFIELD METROPOLITAN DISTRICT Development Projection at 40.000 (target) Mills for Debt Service -- Service Plan Series 2030, G.O. Bonds, Pay & Cancel Refg of (proposed) Series 2020 + New Money, Assumes Investment Grade, 100x, 30-yr. Maturity Series 2020 Ser. 2030 $10,020,000 Par $14,870,000 Par Surplus Senior Senior Cov. of Net DS: Cov. of Net DS: [Net $7.098 MM] [Net $5.829 MM] Total Annual Release Cumulative Debt/ Debt/ @ 40.000 Target @ 40.000 Cap Net Available Net Debt [Escr $9.790 MM] Net Debt Funds on Hand* Surplus 50% D/A Surplus Assessed Act'l Value & 0.0 U.R.A. Mills & 0.0 U.R.A. Mills for Debt Svc Service Net Debt Service Service Used as Source to $1,487,000 $1,487,000 Target Ratio Ratio & Sales PIF Revs & Sales PIF Revs  QD  QD                    1 2050 2049 0 YEAR                                            NORTHFIELD METROPOLITAN DISTRICT Operations Revenue and Expense Projection Total Total S.O. Tax Total Assessed Oper'ns Collections Collections Available Total Value Mill Levy @ 98% @ 98% For O&M Mills                                           NORTHFIELD METROPOLITAN DISTRICT Development Summary 'HYHORSPHQW3URMHFWLRQ%XLOGRXW3ODQ XSGDWHG Residential Development Commercial Development Product Type Stacked Condos Flats Brownstones Value Condo Deed Restricted Condo MU - Studio Apts (For Rent) MU - Retail Base $ ('20) $306,714 $359,040 $388,518 $316,200 $265,200 $200,000 $225/sf Res'l Totals Comm'l Totals                                                                                                                                                                                                                                                                                                                                                                                           442   2,679 09#)XOO%XLOGRXW $12,268,560 $64,627,200 $54,004,002 $5,059,200 $17,238,000 $400,000 $153,596,962 $602,775 $602,775 EDVHSULFHVXQLQIO QRWHV 3ODWWHG'HY/RWV 09RQH\USULRU %DVH09LQIODWHGSHUDQQXP &10')LQ3ODQ 'HY6XPP 3UHSDUHGE\'$'DYLGVRQ &R 4 NORTHFIELD METROPOLITAN DISTRICT 2050 Development Projection -- Buildout Plan (updated 4/25/19) 100% 0 Ph Residential Development Stacked Condos Flats Brownstones Value Condo Incr/(Decr) in Incr/(Decr) in Incr/(Decr) in Incr/(Decr) in Finished Lot # Units Price Finished Lot # Units Price Finished Lot # Units Price Finished Lot # Units Price # Lots Value @ Completed Inflated @ Market # Lots Value @ Completed Inflated @ Market # Lots Value @ Completed Inflated @ Market # Lots Value @ Completed Inflated @ Market YEAR Devel'd 10% 40 target 2% Value Devel'd 10% 180 target 2% Value Devel'd 10% 139 target 2% Value Devel'd 10% 16 target 2% Value                                                                                                                                                                                                                                                                                                                                                                                                                                              BBBBBB BBBBBBBBB BBBBBB BBBBBBBBB BBBBBB BBBBBBBBB BBBBBB BBBBBBBBB BBBBB BBBBBBBBB BBBBBB BBBBBBBBB BBBBB BBBBBBBBB BBBBBB BBBBBBBBB                 &10')LQ3ODQ $EV 3UHSDUHGE\'$'DYLGVRQ &R 5 2050 100% 0 Ph YEAR                      NORTHFIELD METROPOLITAN DISTRICT Development Projection -- Buildout Plan (updated 4/25/19) Residential Summary Deed Restricted Condo MU - Studio Apts (For Rent) Incr/(Decr) in Incr/(Decr) in Finished Lot # Units Price Finished Lot # Units Price Total # Lots Value @ Completed Inflated @ Market # Lots Value @ Completed Inflated @ Market Residential Total Total Total Total Devel'd 10% 65 target 2% Value Devel'd 10% 2 target 2% Value Market Value SFD Units SFA Units MFD Units Res'l Units                                                                                                                                                                                                                                                                                                                    BBBB BBBBBBBBB BBBBBB BBBBBBBBB BBBBB BBBBBBBB BBBBBB BBBBBBBBB BBBBBBBBBBB BBBBBB BBBBBB BBBBBB BBBBBB              &10')LQ3ODQ $EV 3UHSDUHGE\'$'DYLGVRQ &R 6 2050 100% 0 Ph YEAR                      NORTHFIELD METROPOLITAN DISTRICT Development Projection -- Buildout Plan (updated 4/25/19) Commercial Development MU - Retail Incr/(Decr) in Finished Lot Square Ft per Sq Ft, Total Total Value of Platted & SF Value @ Completed Inflated @ Market Commercial Commercial Developed Lots Devel'd 10% 2,679 2% Value Market Value Sq Ft Adjustment1 Adjusted Value                                                                                                                                                                                         BBBBBB BBBBBBBBB BBBBBBBB BBBBBBBBB BBBBBBBBB BBBBBBBBB BBBBBBBBB BBBBBBBBB         >@$GMWRDFWXDOSUHOLP$9 Commercial Summary &10')LQ3ODQ $EV 3UHSDUHGE\'$'DYLGVRQ &R $SUDP3UHSDUHGE\'$'DYLGVRQ &R4XDQWLWDWLYH*URXSa30 1RUWKILHOG0'&$351563& SOURCES AND USES OF FUNDS NORTHFIELD METROPOLITAN DISTRICT GENERAL OBLIGATION BONDS, SERIES 2020 40.000 (target) Mills Non-Rated, 100x, 30-yr. Maturity (SERVICE PLAN: Full Growth + 6.00% Bi-Reassessment Projections) [ Preliminary -- for discussion only ] 'DWHG'DWH  'HOLYHU\'DWH  Sources: %RQG3URFHHGV 3DU$PRXQW   Uses: 3URMHFW)XQG'HSRVLWV 3URMHFW)XQG  2WKHU)XQG'HSRVLWV &DSLWDOL]HG,QWHUHVW)XQG  'HEW6HUYLFH5HVHUYH)XQG   &RVWRI,VVXDQFH 2WKHU&RVWRI,VVXDQFH  'HOLYHU\'DWH([SHQVHV 8QGHUZULWHU V'LVFRXQW   8 $SUDP3UHSDUHGE\'$'DYLGVRQ &R4XDQWLWDWLYH*URXSa30 1RUWKILHOG0'&$351563& BOND SUMMARY STATISTICS NORTHFIELD METROPOLITAN DISTRICT GENERAL OBLIGATION BONDS, SERIES 2020 40.000 (target) Mills Non-Rated, 100x, 30-yr. Maturity (SERVICE PLAN: Full Growth + 6.00% Bi-Reassessment Projections) [ Preliminary -- for discussion only ] 'DWHG'DWH  'HOLYHU\'DWH  )LUVW&RXSRQ  /DVW0DWXULW\  $UELWUDJH<LHOG  7UXH,QWHUHVW&RVW 7,&  1HW,QWHUHVW&RVW 1,&  $OO,Q7,&  $YHUDJH&RXSRQ  $YHUDJH/LIH \HDUV  :HLJKWHG$YHUDJH0DWXULW\ \HDUV  'XUDWLRQRI,VVXH \HDUV  3DU$PRXQW  %RQG3URFHHGV  7RWDO,QWHUHVW  1HW,QWHUHVW  %RQG<HDUVIURP'DWHG'DWH  %RQG<HDUVIURP'HOLYHU\'DWH  7RWDO'HEW6HUYLFH  0D[LPXP$QQXDO'HEW6HUYLFH  $YHUDJH$QQXDO'HEW6HUYLFH  8QGHUZULWHU V)HHV SHU $YHUDJH7DNHGRZQ 2WKHU)HH  7RWDO8QGHUZULWHU V'LVFRXQW  %LG3ULFH  Average Par Average Average Maturity PV of 1 bp Bond Component Value Price Coupon Life Date change 7HUP%RQGGXH          $OO,Q $UELWUDJH 7,& 7,& <LHOG 3DU9DOXH    $FFUXHG,QWHUHVW 3UHPLXP 'LVFRXQW 8QGHUZULWHU V'LVFRXQW   &RVWRI,VVXDQFH([SHQVH  2WKHU$PRXQWV 7DUJHW9DOXH    7DUJHW'DWH    <LHOG    9 $SUDP3UHSDUHGE\'$'DYLGVRQ &R4XDQWLWDWLYH*URXSa30 1RUWKILHOG0'&$351563& BOND DEBT SERVICE NORTHFIELD METROPOLITAN DISTRICT GENERAL OBLIGATION BONDS, SERIES 2020 40.000 (target) Mills Non-Rated, 100x, 30-yr. Maturity (SERVICE PLAN: Full Growth + 6.00% Bi-Reassessment Projections) [ Preliminary -- for discussion only ] Annual Period Debt Debt Ending Principal Coupon Interest Service Service                                                                                                                                                                                                                  $SUDP3UHSDUHGE\'$'DYLGVRQ &R4XDQWLWDWLYH*URXSa30 1RUWKILHOG0'&$351563& NET DEBT SERVICE NORTHFIELD METROPOLITAN DISTRICT GENERAL OBLIGATION BONDS, SERIES 2020 40.000 (target) Mills Non-Rated, 100x, 30-yr. Maturity (SERVICE PLAN: Full Growth + 6.00% Bi-Reassessment Projections) [ Preliminary -- for discussion only ] Capitalized Period Total Debt Service Interest Net Ending Principal Interest Debt Service Reserve Fund Fund Debt Service                                                                                                                                                         11 $SUDP3UHSDUHGE\'$'DYLGVRQ &R4XDQWLWDWLYH*URXSa30 1RUWKILHOG0'&$351563& BOND SOLUTION NORTHFIELD METROPOLITAN DISTRICT GENERAL OBLIGATION BONDS, SERIES 2020 40.000 (target) Mills Non-Rated, 100x, 30-yr. Maturity (SERVICE PLAN: Full Growth + 6.00% Bi-Reassessment Projections) [ Preliminary -- for discussion only ] Period Proposed Proposed Debt Service Total Adj Revenue Unused Debt Serv Ending Principal Debt Service Adjustments Debt Service Constraints Revenues Coverage                                                                                                                                                                                                                  12 $SUDP3UHSDUHGE\'$'DYLGVRQ &R4XDQWLWDWLYH*URXSa30 1RUWKILHOG0'&$35,*63&,*63& SOURCES AND USES OF FUNDS NORTHFIELD METROPOLITAN DISTRICT GENERAL OBLIGATION REFUNDING BONDS, SERIES 2030 Pay & Cancel Refunding of (proposed) Series 2020 + New Money 40.000 (target) Mills Assumes Investment Grade, 100x, 30-yr. Maturity (SERVICE PLAN: Full Growth + 6% Bi-Reassessment Projections) [ Preliminary -- for discussion only ] 'DWHG'DWH  'HOLYHU\'DWH  Sources: %RQG3URFHHGV 3DU$PRXQW  2WKHU6RXUFHVRI)XQGV )XQGVRQ+DQG  6HULHV'65)    Uses: 3URMHFW)XQG'HSRVLWV 3URMHFW)XQG  5HIXQGLQJ(VFURZ'HSRVLWV &DVK'HSRVLW  2WKHU)XQG'HSRVLWV &DSLWDOL]HG,QWHUHVW)XQG  &RVWRI,VVXDQFH 2WKHU&RVWRI,VVXDQFH  'HOLYHU\'DWH([SHQVHV 8QGHUZULWHU V'LVFRXQW   > @(VWLPDWHGEDODQFHV WEG $SUDP3UHSDUHGE\'$'DYLGVRQ &R4XDQWLWDWLYH*URXSa30 1RUWKILHOG0'&$35,*63&,*63& BOND SUMMARY STATISTICS NORTHFIELD METROPOLITAN DISTRICT GENERAL OBLIGATION REFUNDING BONDS, SERIES 2030 Pay & Cancel Refunding of (proposed) Series 2020 + New Money 40.000 (target) Mills Assumes Investment Grade, 100x, 30-yr. Maturity (SERVICE PLAN: Full Growth + 6% Bi-Reassessment Projections) [ Preliminary -- for discussion only ] 'DWHG'DWH  'HOLYHU\'DWH  )LUVW&RXSRQ  /DVW0DWXULW\  $UELWUDJH<LHOG  7UXH,QWHUHVW&RVW 7,&  1HW,QWHUHVW&RVW 1,&  $OO,Q7,&  $YHUDJH&RXSRQ  $YHUDJH/LIH \HDUV  :HLJKWHG$YHUDJH0DWXULW\ \HDUV  'XUDWLRQRI,VVXH \HDUV  3DU$PRXQW  %RQG3URFHHGV  7RWDO,QWHUHVW  1HW,QWHUHVW  %RQG<HDUVIURP'DWHG'DWH  %RQG<HDUVIURP'HOLYHU\'DWH  7RWDO'HEW6HUYLFH  0D[LPXP$QQXDO'HEW6HUYLFH  $YHUDJH$QQXDO'HEW6HUYLFH  8QGHUZULWHU V)HHV SHU $YHUDJH7DNHGRZQ 2WKHU)HH  7RWDO8QGHUZULWHU V'LVFRXQW  %LG3ULFH  Average Par Average Average Maturity PV of 1 bp Bond Component Value Price Coupon Life Date change 7HUP%RQGGXH          $OO,Q $UELWUDJH 7,& 7,& <LHOG 3DU9DOXH    $FFUXHG,QWHUHVW 3UHPLXP 'LVFRXQW 8QGHUZULWHU V'LVFRXQW   &RVWRI,VVXDQFH([SHQVH  2WKHU$PRXQWV 7DUJHW9DOXH    7DUJHW'DWH    <LHOG    14 $SUDP3UHSDUHGE\'$'DYLGVRQ &R4XDQWLWDWLYH*URXSa30 1RUWKILHOG0'&$35,*63&,*63& BOND DEBT SERVICE NORTHFIELD METROPOLITAN DISTRICT GENERAL OBLIGATION REFUNDING BONDS, SERIES 2030 Pay & Cancel Refunding of (proposed) Series 2020 + New Money 40.000 (target) Mills Assumes Investment Grade, 100x, 30-yr. Maturity (SERVICE PLAN: Full Growth + 6% Bi-Reassessment Projections) [ Preliminary -- for discussion only ] Annual Period Debt Debt Ending Principal Coupon Interest Service Service                                                                                                                                                                                                                       $SUDP3UHSDUHGE\'$'DYLGVRQ &R4XDQWLWDWLYH*URXSa30 1RUWKILHOG0'&$35,*63&,*63& NET DEBT SERVICE NORTHFIELD METROPOLITAN DISTRICT GENERAL OBLIGATION REFUNDING BONDS, SERIES 2030 Pay & Cancel Refunding of (proposed) Series 2020 + New Money 40.000 (target) Mills Assumes Investment Grade, 100x, 30-yr. Maturity (SERVICE PLAN: Full Growth + 6% Bi-Reassessment Projections) [ Preliminary -- for discussion only ] Period Total Capitalized Net Ending Principal Interest Debt Service Interest Fund Debt Service                                                                                                                                                            16 $SUDP3UHSDUHGE\'$'DYLGVRQ &R4XDQWLWDWLYH*URXSa30 1RUWKILHOG0'&$35,*63&,*63& SUMMARY OF BONDS REFUNDED NORTHFIELD METROPOLITAN DISTRICT GENERAL OBLIGATION REFUNDING BONDS, SERIES 2030 Pay & Cancel Refunding of (proposed) Series 2020 + New Money 40.000 (target) Mills Assumes Investment Grade, 100x, 30-yr. Maturity (SERVICE PLAN: Full Growth + 6% Bi-Reassessment Projections) [ Preliminary -- for discussion only ] Maturity Interest Par Call Call Bond Date Rate Amount Date Price 6HU1563[POV)*%L5H 7(50                                                                                                      17 $SUDP3UHSDUHGE\'$'DYLGVRQ &R4XDQWLWDWLYH*URXSa30 1RUWKILHOG0'&$35,*63&,*63& ESCROW REQUIREMENTS NORTHFIELD METROPOLITAN DISTRICT GENERAL OBLIGATION REFUNDING BONDS, SERIES 2030 Pay & Cancel Refunding of (proposed) Series 2020 + New Money 40.000 (target) Mills Assumes Investment Grade, 100x, 30-yr. Maturity (SERVICE PLAN: Full Growth + 6% Bi-Reassessment Projections) [ Preliminary -- for discussion only ] 'DWHG'DWH  'HOLYHU\'DWH  4/25/19: Ser 20 NR SP, 5.00%, 100x, 40mls, FG+6% BiRe Period Principal Ending Redeemed Total      18 $SUDP3UHSDUHGE\'$'DYLGVRQ &R4XDQWLWDWLYH*URXSa30 1RUWKILHOG0'&$35,*63&,*63& PRIOR BOND DEBT SERVICE NORTHFIELD METROPOLITAN DISTRICT GENERAL OBLIGATION REFUNDING BONDS, SERIES 2030 Pay & Cancel Refunding of (proposed) Series 2020 + New Money 40.000 (target) Mills Assumes Investment Grade, 100x, 30-yr. Maturity (SERVICE PLAN: Full Growth + 6% Bi-Reassessment Projections) [ Preliminary -- for discussion only ] Annual Period Debt Debt Ending Principal Coupon Interest Service Service                                                                                                                                                                                         19 $SUDP3UHSDUHGE\'$'DYLGVRQ &R4XDQWLWDWLYH*URXSa30 1RUWKILHOG0'&$35,*63&,*63& BOND SOLUTION NORTHFIELD METROPOLITAN DISTRICT GENERAL OBLIGATION REFUNDING BONDS, SERIES 2030 Pay & Cancel Refunding of (proposed) Series 2020 + New Money 40.000 (target) Mills Assumes Investment Grade, 100x, 30-yr. Maturity (SERVICE PLAN: Full Growth + 6% Bi-Reassessment Projections) [ Preliminary -- for discussion only ] Period Proposed Proposed Debt Service Total Adj Revenue Unused Debt Serv Ending Principal Debt Service Adjustments Debt Service Constraints Revenues Coverage                                                                                                                                                                                                                         20 * EXHIBIT G 38%/,&%(1(),76  1257+),(/'0(75232/,7$1',675,&7126 38%/,&%(1(),761$55$7,9( 7KH&LW\RI)RUW&ROOLQV WKH³&LW\´   GHOLYHU\RIDWWDLQDEOHDQGDIIRUGDEOHKRXVLQJFRQVLGHULQJ1RUWKILHOG¶VSUR[LPLW\WRGRZQWRZQ)RUW &ROOLQVDQGKLJKHUWKDQDYHUDJHODQGDQGGHYHORSPHQWFRVWVLQWKLVDUHD 1RUWKILHOGSODQVWRRIIHUDSSUR[LPDWHO\RIWKHWRWDOSURMHFWDVDIIRUGDEOHKRXVLQJXQLWV DW$0,RUORZHU7KHVHXQLWVZRXOGEHGHOLYHUHGZLWKOHJDOO\HQIRUFHDEOHJXDUDQWHHVIRU DIIRUGDEOHKRXVLQJFRPPLWPHQWVVXFKDVGHHGUHVWULFWLRQVIRUDPLQLPXPRI\HDUV$VRIWKH VXEPLWWDO RI WKLV VHUYLFH SODQ /DQGPDUN KDV D VLJQHG /2, ZLWK0HUF\ +RXVLQJDYHU\ ZHOO HVWDEOLVKHGDIIRUGDEOHIRUUHQWPXOWLIDPLO\EXLOGHUWKDWKDVSURMHFWVDURXQGWKHQDWLRQ$OWKRXJK QRQELQGLQJWKLV/2,SRVHVDJUHDWZD\WKDW/DQGPDUNFDQGHOLYHURQLWVSURPLVHRIDIIRUGDEOH KRPHVZLWKWKHDSSURYDORID0HWUR'LVWULFW$FRS\RIWKH/2,KDVEHHQLQFOXGHGDVDQH[KLELW EHORZ $GGLWLRQDOO\WKHUHPDLQLQJKRXVLQJXQLWVLQWKHSURMHFWDUHH[SHFWHGWREHSULFHGLQDQ DWWDLQDEOHUDQJHFRQVLGHUHGE\RWKHUFLWLHVWREHEHWZHHQDQGRI$0, 3UR[LPLW\WR(PSOR\PHQW&HQWHUV (PSOR\HH&RXQWV6KRZQRQ0DS   JDLQKLJKTXDOLW\DWWDLQDEOHKRXVLQJQHDUWKH&LW\¶VHFRQRPLFDQGFXOWXUDOFRUHKHOSLQJUHGXFH FRQJHVWLRQLQWKH&LW\DQGSURYLGHZRUNIRUFHKRXVLQJ  (QYLURQPHQWDO6XVWDLQDELOLW\ D   E   ULJKWRIZD\WRWKHDUWHULDOURDG6HHLPDJHVEHORZIRUFURVVVHFWLRQFRPSDULVRQVRIWKH52: UHTXLUHGIRUDQ$UWHULDO6WUHHWYVD&RQQHFWRU/RFDO6WUHHW   7KHFRPPXQLW\JDLQVDYLWDOSLHFHRIUHJLRQDOFRQQHFWLYLW\WKDWDOOHYLDWHVPDQ\ WUDIILF FRQFHUQV LQ WKH DUHD SDUWLFXODUO\ DW WKH LQWHUVHFWLRQ RI 9LQH  /HPD\ LQ WKH 1RUWK &ROOHJH9LQH'ULYH(QKDQFHG7UDYHO&RUULGRU    E    F    6PDUW *URZWK 0DQDJHPHQW DQG &RPPXQLW\ DQG 1HLJKERUKRRG /LYDELOLW\ 1RUWKILHOGIXUWKHUVWKH&LW\¶VREMHFWLYHVIRU6PDUW*URZWK0DQDJHPHQWDQG&RPPXQLW\ DQGQHLJKERUKRRG/LYDELOLW\$OWKRXJK1RUWKILHOGZLOOPHHWWKH&LW\¶VGHILQLWLRQRIDQ³DIIRUGDEOH KRXVLQJSURMHFW´ZKLFKZRXOGDOORZIRULQFUHDVHGGHQVLW\WRXQLWVSHUDFUH1RUWKILHOGSODQVWR NHHSGHQVLW\DWXQLWVSHUDFUH5HPDLQLQJDWWKLVORZHUGHQVLW\HQDEOHV1RUWKILHOG¶VRWKHUVWUHWFK RXWFRPHVLQFOXGLQJFRQVWUXFWLQJ6XQLJD5RDGDVDQDUWHULDOURDGDQGLQFUHDVLQJWKHEXIIHU]RQH WRSURWHFWWKH/DNH&DQDO:HWODQGV /RZHU SURMHFWZLGH GHQVLW\ DOVR SURYLGHV 1RUWKILHOG¶V UHVLGHQWV DQG WKH VXUURXQGLQJ FRPPXQLW\ZLWKDPRUHDWWUDFWLYHUHVLGHQWLDODUHDLQFOXGLQJPRUHODQGVFDSHGDQGRSHQVSDFHDUHD WKDQVLPLODUO\VL]HGSURMHFWV&XUUHQWDUHDFRYHUDJHFDOFXODWLRQVSXWWKHDPRXQWRIODQGVFDSHGDQG RSHQVSDFHDWDFUHVRURIWKHHQWLUHVLWH7KLVLVDPXFKKLJKHUSURSRUWLRQRIRSHQ VSDFH FRPSDUHG WR VLPLODU UHVLGHQWLDO SURMHFWV DQG HVSHFLDOO\ FRPSDUHG WR VLQJOHIDPLO\ GHYHORSPHQWV1RUWKILHOG¶VGHQVLW\LVDOVRWKHORZHVWRIDQ\UHFHQWSURMHFWZLWKVLPLODUSURGXFW W\SHVWKDW/DQGPDUN+RPHVKDVGHYHORSHGLQ1RUWKHUQ&RORUDGR 6HHWDEOHEHORZ   1RUWKILHOGZLOODOVRIHDWXUHDFOXEKRXVHDQGDPL[HGXVHEXLOGLQJQHDUWKHUHJLRQDOWUDLOWR VHUYHWKHFRPPXQLW\DWODUJH7KHFOXEKRXVHZLOOSURYLGHDPHQLWLHVLQFOXGLQJDVZLPPLQJSRRO ZRUNRXWIDFLOLW\NLWFKHQDQGJDWKHULQJVSDFHIRUUHVLGHQWVDQGSXEOLF7KHPL[HGXVHFHQWHUZLOO RIIHUOLJKWFRPPHUFLDOXVHRQWKHILUVWIORRUUHVLGHQWLDOIRUUHQWXQLWVRQWKHVHFRQGIORRUDQGVPDOO DPHQLWLHV RSHQ WR WKH SXEOLF HJ ELNH UHSDLU VWDWLRQ GRJJLH VWDWLRQ   1RUWKILHOG ZLOO DOVR SURPRWH WKH &LW\¶V REMHFWLYH RI SUHVHUYLQJ DQG HQKDQFLQJ KLVWRULF UHVRXUFHV7KHVRXWKHDVWHUQHGJHRI1RUWKILHOGERUGHUVWKHWREHGHVLJQDWHGKLVWRULF$OWD9LVWD QHLJKERUKRRG7REOHQGWKHWUDQVLWLRQWRQHZGHYHORSPHQWDQGSD\KRPDJHWRWKHQHLJKERUKRRG¶V KLVWRU\1RUWKILHOGZLOOIHDWXUHDQ,QWHUSUHWLYH+LVWRULFDO3DUNDQG*DWHZD\)HDWXUHVERUGHULQJ $OWD 9LVWD 7KHVH DGGLWLRQV ZHUH GHYHORSHG LQ FROODERUDWLRQ ZLWK QHLJKERUV LQ WKH $OWD 9LVWD QHLJKERUKRRGDQGZRXOGSURYLGHDQH[WUDRUGLQDU\EHQHILWWRWKH&LW\DVDZKROH     38%/,&%(1(),761$55$7,9( ([KLELW0HUF\+RXVLQJ/2, dŽƚĂůĞŶĞĨŝƚ WĞƌͲhŶŝƚĞŶĞĨŝƚ EŽƚĞƐ ŶǀŝƌŽŶŵĞŶƚĂů^ƵƐƚĂŝŶĂďŝůŝƚLJ ŶĞƌŐLJĨĨŝĐŝĞŶƚ,ŽŵĞƐ ϭͿ,Z^ƌĂƚŝŶŐƐƌĂŶŐŝŶŐĨƌŽŵϰϵͲϱϱ Ψϭ͕Ϯϲϭ͕ϬϬϬ ΨϮ͕ϴϱϯ ŶĞƌŐLJĞĨĨŝĐŝĞŶƚďƵŝůĚŝŶŐŵĂƚĞƌŝĂůƐĂŶĚĐĞƌƚŝĨŝĐĂƚŝŽŶĨĞĞƐ ^ŽůĂƌŶĞƌŐLJ ϭͿϭϯͲϭϰŬtŽĨƐŽůĂƌƉŽǁĞƌƉĞƌΗ&ůĂƚƐΗďƵŝůĚŝŶŐ Ψϰϰϴ͕ϬϬϬ Ψϭ͕Ϭϭϰ ΨϮϴ͕ϬϬϬƉĞƌďƵŝůĚŝŶŐ͖ϭϴϬƵŶŝƚƐďĞŶĞĨŝƚ ůĞĐƚƌŝĐsĞŚŝĐůĞƐ ϭͿϮϰϬsǁŝƌŝŶŐĂŶĚŽƵƚůĞƚƐ Ψϯϳϱ͕ϬϬϬ Ψϴϰϴ /ŶĞǀĞƌLJŐĂƌĂŐĞ ϮͿsĐŚĂƌŐŝŶŐƐƚĂƚŝŽŶƐ ΨϯϬ͕ϬϬϬ Ψϲϴ ƌŝƚŝĐĂůWƵďůŝĐ/ŶĨƌĂƐƚƌƵĐƚƵƌĞ DĂũŽƌƌƚĞƌŝĂůĞǀĞůŽƉŵĞŶƚ ϭͿKŶͲ^ŝƚĞ^ƵŶŝŐĂZŽĂĚhƉƐŝnjŝŶŐ Ψϭ͕ϲϴϮ͕ϲϰϬ Ψϯ͕ϴϬϳ hƉƐŝnjŝŶŐĐŽƐƚĨƌŽŵĂƚLJƉŝĐĂůϮͲůĂŶĞĐŽŶŶĞĐƚŽƌ ϭͿKĨĨͲ^ŝƚĞ^ƵŶŝŐĂZŽĂĚ Ψϳϳϰ͕ϴϬϬ Ψϭ͕ϳϱϯ KĨĨƐŝƚĞĐŽŶƐƚƌƵĐƚŝŽŶĨƌŽŵZĞĚǁŽŽĚƚŽ>ĂŬĞĂŶĂů WĞĚĞƐƚƌŝĂŶŽŶŶĞĐƚŝǀŝƚLJ ϭͿZĞŐŝŽŶĂůdƌĂŝůŽŶƐƚƌƵĐƚŝŽŶ Ψϭϵϵ͕ϬϱϬ ΨϰϱϬ KĨĨͲ^ŝƚĞ/ŶĨƌĂƐƚƌƵĐƚƵƌĞ ϭͿKĨĨͲ^ŝƚĞ^ĞǁĞƌŽŶƐƚƌƵĐƚŝŽŶΘhƉƐŝnjŝŶŐ Ψϱϯϴ͕ϮϮϬ Ψϭ͕Ϯϭϴ dŽďĞŶĞĨŝƚEŽƌƚŚĨŝĞůĚĂŶĚƚŚĞƐƵƌƌŽƵŶĚŝŶŐĂƌĞĂƐĨƌŽŵĂĨĂŝůŝŶŐƐĞǁĞƌůŝŶĞ ϮͿ>ĞŵĂLJKǀĞƌƉĂƐƐŽŶƚƌŝďƵƚŝŽŶ Ψϰϭϲ͕ϬϬϬ Ψϵϰϭ ϯͿEKƐƚŽƌŵǁĂƚĞƌĨĞĞ ΨϯϴϮ͕ϱϵϴ Ψϴϲϲ ^ŵĂƌƚ'ƌŽǁƚŚDĂŶĂŐĞŵĞŶƚ /ŶĐƌĞĂƐĞĚĞŶƐŝƚLJ ϭͿůůĞLJͲ>ŽĂĚĞĚ,ŽŵĞƐ ΨϴϮϬ͕ϴϬϬ Ψϭ͕ϴϱϳ DĞƚƌŽŝƐƚƌŝĐƚŵĂŝŶƚĂŝŶĞĚ WƵďůŝĐ^ƉĂĐĞƐ ϭͿZĞĚƵĐƚŝŽŶŝŶůůŽǁĞĚĞŶƐŝƚLJͬDŽƌĞKƉĞŶ^ƉĂĐĞ Ψϰ͕ϰϳϰ͕ϭϬϬ ΨϭϬ͕ϭϮϮ EŽƌƚŚĨŝĞůĚŝƐĂƚϴƵŶŝƚƐͬĂĐƌĞǀƐƚŚĞĂůůŽǁĞĚϭϮƵŶŝƚƐͬĂĐƌĞƉĞƌƚŚĞΗĂĨĨŽƌĚĂďůĞ ŚŽƵƐŝŶŐƉƌŽũĞĐƚΗůĂŶĚƵƐĞĚĞĨŝŶŝƚŝŽŶ ϮͿůƵƵƐĞΘ^ǁŝŵŵŝŶŐWŽŽů ΨϮ͕ϬϬϬ͕ϬϬϬ Ψϰ͕ϱϮϱ ϯͿ/ŶĐƌĞĂƐĞĚ>ĂŶĚƐĐĂƉĞĚƌĞĂ;ϰϲ͘ϵйŽĨƐŝƚĞͿ ΨϳϮϯ͕ϴϬϬ Ψϭ͕ϲϯϴ >ĂŶĚƐĐĂƉĞĚĂƌĞĂďĞLJŽŶĚĂƚLJƉŝĐĂůƉƌŽũĞĐƚ ϰͿůƚĂsŝƐƚĂƵĨĨĞƌƌĞĂ ΨϭϮϱ͕ϬϬϬ ΨϮϴϯ ^ĞƉĞƌĂƚĞƐĂŶĚƉƌŽƚĞĐƚƐƚŚĞůƚĂsŝƐƚĂŶĞŝŐŚďŽƌŚŽŽĚĨƌŽŵ^ƵŶŝŐĂ ϱͿWƵďůŝĐĂŵĞŶŝƚLJĂƌĞĂ Ψϱ͕ϬϬϬ Ψϭϭ WƵďůŝĐƵƐĞĂŵĞŶŝƚŝĞƐƐƚĂƚŝŽŶĞĚĂůŽŶŐƌĞŐŝŽŶĂůƚƌĂŝů ^ƚƌĂƚĞŐŝĐWƌŝŽƌŝƚŝĞƐ ĨĨŽƌĚĂďůĞ,ŽƵƐŝŶŐ ϭͿϭϰ͘ϳй;ϲϱƵŶŝƚƐͿŽĨĚĞĞĚͲƌĞƐƚƌŝĐƚĞĚĂĨĨŽƌĚĂďůĞŚŽƵƐŝŶŐ Ψϰ͕ϰϮϬ͕ϬϬϬ ΨϭϬ͕ϬϬϬ Ψϲϴ͕ϬϬϬƐƵďƐŝĚLJƉĞƌƵŶŝƚƚŽƉƌŝĐĞďĞůŽǁϴϬйD/ ƚƚĂŝŶĂďůĞ,ŽƵƐŝŶŐ ϭͿϴϱ͘ϯй;ϯϳϳƵŶŝƚƐͿŽĨĂƚƚĂŝŶĂďůLJƉƌŝĐĞĚŚŽƵƐŝŶŐ ŝĨĨŝĐƵůƚƚŽYƵĂŶƚ͘ ŝĨĨŝĐƵůƚƚŽYƵĂŶ͘ ZĞŵĂŝŶĚĞƌŽĨƉƌŽũĞĐƚǁŝůůďĞƉƌŝĐĞĚŝŶĂƌĂŶŐĞƚŚĂƚƐŽŵĞŽŶĞŵĂŬŝŶŐϴϬйƚŽ ϭϮϬйŽĨD/ĐŽƵůĚĂĨĨŽƌĚ dKd>Wh>/E&/d^ Ψϭϴ͕ϲϳϲ͕ϬϬϴ ΨϰϮ͕Ϯϱϯ hŶŝƚƐ͗ ϰϰϮ EŽŶͲĂƐŝĐ/ŵƉƌŽǀĞŵĞŶƚƐ ŝƐĐůĂŝŵĞƌ͗dŚĞďĞŶĞĨŝƚƐůŝƐƚĞĚĂďŽǀĞƌĞƐƉƌĞƐĞŶƚĂƉƌĞůŝŵŝŶĂƌLJĞƐƚŝŵĂƚĞŝŶŽƌĚĞƌƚŽƉƌŽǀŝĚĞŝůůƵƐƚƌĂƚŝǀĞƌĞƉƌĞƐĞŶƚĂƚŝŽŶŽĨƚŚĞǀĂůƵĞĨŽƌƉƵďůŝĐďĞŶĞĨŝƚ͘dŚĞŝůůƵƐƚƌĂƚŝŽŶŝƐŶŽŶͲďŝŶĚŝŶŐ ƉĞŶĚŝŶŐƚŚĞĞdžĞĐƵƚŝŽŶŽĨĂĚĞǀĞůŽƉŵĞŶƚĂŐƌĞĞŵĞŶƚ EŽƌƚŚĨŝĞůĚDĞƚƌŽŝƐƚƌŝĐƚWƵďůŝĐĞŶĞĨŝƚƐǀĂůƵĂƚŝŽŶ + EXHIBIT H ',6&/2685(127,&(  ªª NOTICE OF INCLUSION IN A RESIDENTIAL METROPOLITAN DISTRICT AND POSSIBLE PROPERTY TAX CONSEQUENCES  /HJDOGHVFULSWLRQRIWKHSURSHUW\DQGDGGUHVV $WWDFKHGKHUHWRDV([KLELW$ 7KLVSURSHUW\LVORFDWHGLQWKHIROORZLQJPHWURSROLWDQGLVWULFW 1RUWKILHOG0HWURSROLWDQ'LVWULFW1RBB ,QDGGLWLRQWRVWDQGDUGSURSHUW\WD[HVLGHQWLILHGRQWKHQH[WSDJHWKLVSURSHUW\ LVVXEMHFWWRD PHWURSROLWDQGLVWULFWPLOOOHY\ DQRWKHUSURSHUW\WD[  (67,0$7(2)3523(57<7$;(6  Annual Tax Levied on Residential Property With $300,000 Actual Value Without the District 7D[LQJ(QWLW\ 0LOO/HYLHV    7KLVHVWLPDWHRIPLOOOHYLHVLVEDVHGXSRQPLOOOHYLHVFHUWLILHGE\WKH/DULPHU&RXQW\$VVHVVRU¶V2IILFHLQ'HFHPEHU IRUFROOHFWLRQLQDQGLVLQWHQGHGRQO\WRSURYLGHDSSUR[LPDWLRQVRIWKHWRWDORYHUODSSLQJPLOOOHYLHVZLWKLQ WKH'LVWULFW7KHVWDWHGPLOOOHYLHVDUHVXEMHFWWRFKDQJHDQG\RXVKRXOGFRQWDFWWKH/DULPHU&RXQW\$VVHVVRU¶V2IILFH WRREWDLQDFFXUDWHDQGFXUUHQWLQIRUPDWLRQ                                       ([KLELW$ 3URSHUW\ + EXHIBIT I )2502),17(5*29(510(17$/$*5((0(17 INTERGOVERNMENTAL AGREEMENT 7+,6,17(5*29(510(17$/$*5((0(17 WKLV³$JUHHPHQW´  *RYHUQLQJ/DZ9HQXH7KLV$JUHHPHQWVKDOOEHJRYHUQHGE\DQGFRQVWUXHGXQGHU WKHDSSOLFDEOHODZVRIWKH6WDWHRI&RORUDGR9HQXHIRUDQ\MXGLFLDODFWLRQWRLQWHUSUHWRUHQIRUFH WKLV$JUHHPHQWVKDOOEHLQ/DULPHU&RXQW\'LVWULFW&RXUWRIWKH(LJKWK-XGLFLDO'LVWULFWIRUWKH 6WDWHRI&RORUDGR  %HQHILFLDULHV([FHSWDVRWKHUZLVHVWDWHGKHUHLQWKLV$JUHHPHQWLVLQWHQGHGWRRQO\ GHVFULEHWKHULJKWVDQGUHVSRQVLELOLWLHVRIDQGEHWZHHQWKHQDPHG3DUWLHVDQGLVQRWLQWHQGHGWR DQGVKDOOQRWEHGHHPHGWRFRQIHUDQ\ULJKWVXSRQDQ\RWKHUSHUVRQVRUHQWLWLHVQRWQDPHGDVSDUWLHV LQWKLV$JUHHPHQW  (IIHFW RI ,QYDOLGLW\ ,I DQ\ SRUWLRQ RI WKLV $JUHHPHQW LV KHOG LQYDOLG RU XQHQIRUFHDEOHIRUDQ\UHDVRQE\DFRXUWRIFRPSHWHQWMXULVGLFWLRQDVWRDQ\RUDOOWKH3DUWLHVVXFK SRUWLRQVKDOOEHGHHPHGVHYHUDEOHDQGLWVLQYDOLGLW\RULWVXQHQIRUFHDELOLW\VKDOOQRWFDXVHWKHHQWLUH $JUHHPHQWWREHWHUPLQDWHG  $VVLJQDELOLW\1HLWKHUWKH&LW\QRUWKH'LVWULFWVVKDOODVVLJQWKHLUULJKWVRUGHOHJDWH WKHLUGXWLHVKHUHXQGHUZLWKRXWWKHSULRUZULWWHQFRQVHQWRIWKHRWKHU3DUWLHV$Q\DVVLJQPHQWRI ULJKWVRUGHOHJDWLRQRIGXWLHVZLWKRXWVXFKSULRUZULWWHQFRQVHQWVKDOOEHGHHPHGQXOODQGYRLGDQG RIQRHIIHFW1RWZLWKVWDQGLQJWKHIRUHJRLQJWKH&LW\DQGWKH'LVWULFWVPD\HQWHULQWRFRQWUDFWVRU RWKHUDJUHHPHQWVZLWKWKLUGSDUWLHVWRSHUIRUPDQ\RIWKHLUUHVSHFWLYHGXWLHVUHTXLUHGXQGHUWKLV $JUHHPHQW  6XFFHVVRUV DQG$VVLJQV7KLV$JUHHPHQW DQG WKH ULJKWVDQGREOLJDWLRQVFUHDWHG KHUHE\VKDOOEHELQGLQJXSRQDQGLQXUHWRWKHEHQHILWRIWKH3DUWLHVDQGWKHLUUHVSHFWLYHVXFFHVVRUV DQGDVVLJQV 1257+),(/' 0(75232/,7$1 ',675,&712   %\   3UHVLGHQW $77(67     1257+),(/' 0(75232/,7$1 ',675,&712   %\   3UHVLGHQW $77(67     1257+),(/' 0(75232/,7$1 ',675,&712   %\   3UHVLGHQW $77(67     &,7<2))257&2//,16   %\  0D\RU $77(67   &LW\&OHUN  2165.0003: 983698 CITY OF FORT COLLINS, COUNTY OF LARIMER, STATE OF COLORADO CERTIFICATION OF MAILING NOTICE OF PUBLIC HEARING IN RE NORTHFIELD METROPOLITAN DISTRICT NOS. 1-3, CITY OF FORT COLLINS, COUNTY OF LARIMER, STATE OF COLORADO I, Catherine V. Will, of lawful age and duly sworn, state: 1. I am a paralegal at the law firm of White Bear Ankele Tanaka & Waldron acting on behalf of the proposed District in the above captioned matter. 2. That, pursuant to Section 3(H) of the City of Fort Collins Policy for Reviewing Service Plans for Metropolitan Districts, the Notice of Public Hearing on Service Plan, a copy of which is attached hereto as Exhibit A, was provided by U.S. first class mail on July 19, 2019, to the owners of record of all real property within the District as such owners of record are listed in the proposed service plan, as set forth on the list attached hereto as Exhibit B. Signed this 7th day of August, 2019. By: Catherine V. Will EXHIBIT B EXHIBIT A NOTICE OF PUBLIC HEARING ON SERVICE PLAN NOTICE OF PUBLIC HEARING FOR THE ORGANIZATION OF A SPECIAL DISTRICT IN RE THE ORGANIZATION OF NORTHFIELDMETROPOLITAN DISTRICT NOS. 1-3, CITY OF FORT COLLINS, COUNTY OF LARIMER, STATE OF COLORADO NOTICE IS HEREBY GIVEN that, pursuant to § 32-1-204(1), C.R.S., a Service Plan (the “Service Plan”) for the proposed Northfield Metropolitan District Nos. 1-3 (“Districts”) has been filed and is available for public inspection in the office of the City Clerk of the City of Ft. Collins. A public hearing on the Service Plan will be held by the City Council of the City of Ft. Collins (the “City Council”) on Tuesday, August 20, 2019, at 6:00 p.m., at City Council Chambers, City Hall West, 300 LaPorte Avenue, Ft. Collins, Colorado, or as soon thereafter as the City Council may hear such matter. The Districts are metropolitan districts. Public improvements authorized to be planned, designed, acquired, constructed, installed, relocated, redeveloped and financed, specifically including related eligible costs for acquisition and administration, as authorized by the Special District Act, except as specifically limited in the Districts’ Service Plan to serve the future taxpayers and property owners of the Districts as determined by the Board of the Districts in its discretion. The maximum mill levy each District is permitted to impose upon the taxable property within its boundaries and shall be Fifty (50) mills for district improvements and operating costs, subject to certain terms as set forth in the Service Plan. The proposed districts will be generally located west of North Lemay Avenue, south of the Lake Canal, and north of the Alta Vista neighborhood, City of Fort Collins, Larimer County, Colorado, currently known as Assessor Parcel Number 9701400002, containing approximately 56.3 acres, as further described in the Service Plan. NOTICE IS FURTHER GIVEN that pursuant to § 32-1-203(3.5), C.R.S., any person owning property in the proposed Districts may request that such property be excluded from the Districts by submitting such request to the Fort Collins City Council no later than ten days prior to the public hearing. All protests and objections must be submitted in writing to the City Manager at or prior to the public hearing or any continuance or postponement thereof in order to be considered. All protests and objections to the Districts shall be deemed to be waived unless presented at the time and in the manner specified herein. BY ORDER OF THE CITY COUNCIL OF THE CITY OF FORT COLLINS EXHIBIT B MAILING LIST OF PROPERTY OWNERS Mailing List of Property Owners SCHLAGEL DONALD E/LL/RH M H/ARVIDSON SL/ROBERTO EG/EJ 1131 LINDENMEIER RD FORT COLLINS, CO 80524 EXHIBIT C 2165.0003: 987085 CITY OF FORT COLLINS, COUNTY OF LARIMER, STATE OF COLORADO CERTIFICATION OF MAILING NOTICE OF PUBLIC HEARING IN RE NORTHFIELD METROPOLITAN DISTRICT NOS. 1-3, CITY OF FORT COLLINS, COUNTY OF LARIMER, STATE OF COLORADO I, Catherine V. Will, of lawful age and duly sworn, state: 1. I am a paralegal at the law firm of White Bear Ankele Tanaka & Waldron acting on behalf of the proposed District in the above captioned matter. 2. That, pursuant to Section 3(H) of the City of Fort Collins Policy for Reviewing Service Plans for Metropolitan Districts, the Notice of Public Hearing on Service Plan, a copy of which is attached hereto as Exhibit A, was provided by U.S. first class mail on August 22, 2019, to the owners of record of all real property within the District as such owners of record are listed in the proposed service plan, as set forth on the list attached hereto as Exhibit B. Signed this 27th day of August, 2019. By: Catherine V. Will EXHIBIT A NOTICE OF PUBLIC HEARING ON SERVICE PLAN NOTICE OF PUBLIC HEARING FOR THE ORGANIZATION OF A SPECIAL DISTRICT IN RE THE ORGANIZATION OF NORTHFIELDMETROPOLITAN DISTRICT NOS. 1-3, CITY OF FORT COLLINS, COUNTY OF LARIMER, STATE OF COLORADO NOTICE IS HEREBY GIVEN that, pursuant to § 32-1-204(1), C.R.S., a Service Plan (the “Service Plan”) for the proposed Northfield Metropolitan District Nos. 1-3 (“Districts”) has been filed and is available for public inspection in the office of the City Clerk of the City of Ft. Collins. A public hearing on the Service Plan that was scheduled to be held by the City Council of the City of Ft. Collins (the “City Council”) on Tuesday, August 20, 2019, at 6:00 p.m., was continued by the City Council. A public hearing on the Service Plan will be held by the City Council on Tuesday, September 3, 2019, at 6:00 p.m. at City Council Chambers, City Hall West, 300 LaPorte Avenue, Ft. Collins, Colorado, or as soon thereafter as the City Council may hear such matter. The Districts are metropolitan districts. Public improvements authorized to be planned, designed, acquired, constructed, installed, relocated, redeveloped and financed, specifically including related eligible costs for acquisition and administration, as authorized by the Special District Act, except as specifically limited in the Districts’ Service Plan to serve the future taxpayers and property owners of the Districts as determined by the Board of the Districts in its discretion. The maximum mill levy each District is permitted to impose upon the taxable property within its boundaries and shall be Fifty (50) mills for district improvements and operating costs, subject to certain terms as set forth in the Service Plan. The proposed districts will be generally located west of North Lemay Avenue, south of the Lake Canal, and north of the Alta Vista neighborhood, City of Fort Collins, Larimer County, Colorado, currently known as Assessor Parcel Number 9701400002, containing approximately 56.3 acres, as further described in the Service Plan. NOTICE IS FURTHER GIVEN that pursuant to § 32-1-203(3.5), C.R.S., any person owning property in the proposed Districts may request that such property be excluded from the Districts by submitting such request to the Fort Collins City Council no later than ten days prior to the public hearing. All protests and objections must be submitted in writing to the City Manager at or prior to the public hearing or any continuance or postponement thereof in order to be considered. All protests and objections to the Districts shall be deemed to be waived unless presented at the time and in the manner specified herein. BY ORDER OF THE CITY COUNCIL OF THE CITY OF FORT COLLINS EXHIBIT B MAILING LIST OF PROPERTY OWNERS Mailing List of Property Owners SCHLAGEL DONALD E/LL/RH M H/ARVIDSON SL/ROBERTO EG/EJ 1131 LINDENMEIER RD FORT COLLINS, CO 80524 LVPDGHDQGHQWHUHG LQWRE\DQGEHWZHHQWKHCity of Fort Collins, ColoradoD&RORUDGRKRPHUXOHPXQLFLSDOLW\ WKH ³&LW\´  DQG Northfield Metropolitan District Nos. 1-3 TXDVLPXQLFLSDO FRUSRUDWLRQV DQG SROLWLFDOVXEGLYLVLRQVRIWKH6WDWHRI&RORUDGR FROOHFWLYHO\ WKH³'LVWULFWV´ 7KH&LW\ DQG WKH 'LVWULFWVVKDOOEHFROOHFWLYHO\UHIHUUHGWRDVWKH³3DUWLHV´ RECITALS :+(5($6WKH'LVWULFWVZHUHRUJDQL]HGWRSURYLGHWKRVHVHUYLFHVDQGWRH[HUFLVHSRZHUV DVDUHPRUHVSHFLILFDOO\VHWIRUWKLQWKH'LVWULFWV¶6HUYLFH3ODQGDWHGBBBBBBBBBBBBBBBBBBB ZKLFKPD\EHDPHQGHGIURPWLPHWRWLPHDVVHWIRUWKWKHUHLQ WKH³6HUYLFH3ODQ´ DQG :+(5($6WKH6HUYLFH3ODQUHTXLUHVWKHH[HFXWLRQRIDQLQWHUJRYHUQPHQWDODJUHHPHQW EHWZHHQ WKH &LW\ DQG WKH 'LVWULFWVWRSURYLGHWKH&LW\ZLWKFRQWUDFW UHPHGLHV WR HQIRUFH WKH UHTXLUHPHQWVDQGOLPLWDWLRQVLPSRVHGRQWKH'LVWULFWVLQWKH6HUYLFH3ODQDQG :+(5($6WKH&LW\DQGWKH'LVWULFWVKDYHGHWHUPLQHGLWWREHLQWKHLUEHVWLQWHUHVWVWR HQWHULQWRWKLV$JUHHPHQWDVSURYLGHGLQWKH6HUYLFH3ODQ 12:7+(5()25(IRUDQGLQFRQVLGHUDWLRQRIWKHFRYHQDQWVDQGPXWXDODJUHHPHQWV KHUHLQFRQWDLQHGDQGIRURWKHUJRRGDQGYDOXDEOHFRQVLGHUDWLRQWKHUHFHLSWDQGVXIILFLHQF\RI ZKLFKDUHKHUHE\DFNQRZOHGJHGWKH3DUWLHVDJUHHDVIROORZV COVENANTS AND AGREEMENTS  ,QFRUSRUDWLRQ E\ 5HIHUHQFH 7KH 6HUYLFH 3ODQ LV KHUHE\ LQFRUSRUDWHG LQ WKLV $JUHHPHQWE\WKLVUHIHUHQFH7KH'LVWULFWVDJUHHWRFRPSO\ZLWKDOOSURYLVLRQVRIWKH6HUYLFH3ODQ DV LW PD\ EH DPHQGHG IURP WLPH WR WLPH LQ DFFRUGDQFH ZLWK WKH SURYLVLRQV WKHUHRI DQG WKH SURYLVLRQVRI$UWLFOHRI7LWOHRIWKH&RORUDGR5HYLVHG6WDWXWHV WKH6SHFLDO'LVWULFW$FW  &DSLWDOL]HGWHUPVXVHGKHUHLQQRWRWKHUZLVHGHILQHGLQWKLV$JUHHPHQWVKDOOKDYHWKHPHDQLQJV UHVSHFWIXOO\VSHFLILHGLQWKH6HUYLFH3ODQ  &LW\3ULRU$SSURYDOV7KH'LVWULFWVVKDOOREWDLQDQ\SULRU&LW\&LW\0DQDJHURU &LW\&RXQFLODSSURYDOVDVUHTXLUHGLQWKH6HUYLFH3ODQEHIRUHXQGHUWDNLQJDQ\DFWLRQUHTXLULQJ VXFKDSSURYDO  (QIRUFHPHQW7KH3DUWLHVDJUHHWKDWWKLV$JUHHPHQWPD\EHHQIRUFHGDWODZRULQ HTXLW\ LQFOXGLQJ DFWLRQV VHHNLQJ VSHFLILF SHUIRUPDQFH PDQGDPXV SURKLELWRU\ RU PDQGDWRU\ LQMXQFWLYHUHOLHIRURWKHUDSSURSULDWHUHOLHI7KH3DUWLHVDOVRDJUHHWKDWWKLV$JUHHPHQWPD\EH HQIRUFHGSXUVXDQWWR&566HFWLRQDQGRWKHUSURYLVLRQVRIWKH6SHFLDO'LVWULFW$FW JUDQWLQJULJKWVWRPXQLFLSDOLWLHVRUFRXQWLHVDSSURYLQJDVHUYLFHSODQRIDVSHFLDOGLVWULFW  $PHQGPHQW7KLV$JUHHPHQWPD\EHDPHQGHGPRGLILHGFKDQJHGRUWHUPLQDWHG LQZKROHRULQSDUWRQO\E\DZULWWHQDJUHHPHQWGXO\DXWKRUL]HGDQGH[HFXWHGE\WKH3DUWLHVKHUHWR  $QQXDOWD[OHYLHG  3RXGUH5*HQHUDO)XQG    /DULPHU&RXQW\    3RXGUH5%RQG3D\PHQW    &LW\RI)RUW&ROOLQV    3RXGUH5LYHU3XEOLF/LEUDU\'LVWULFW    +HDOWK'LVWULFWRI1RUWKHUQ/DULPHU&RXQW\    1RUWKHUQ&RORUDGR:DWHU&RQV'LVWULFW    /DULPHU&RXQW\3HVW&RQWURO'LVWULFW     727$/    Annual Tax Levied on Residential Property With $300,000 Actual Value With the District (Assuming Maximum District Mill Levy) 7D[LQJ(QWLW\ 0LOO/HYLHV   $QQXDOWD[OHYLHG  1RUWKILHOG0HWURSROLWDQ'LVWULFW1RBB    3RXGUH5*HQHUDO)XQG    /DULPHU&RXQW\    3RXGUH5%RQG3D\PHQW    &LW\RI)RUW&ROOLQV    3RXGUH5LYHU3XEOLF/LEUDU\'LVWULFW    +HDOWK'LVWULFWRI1RUWKHUQ/DULPHU&RXQW\    1RUWKHUQ&RORUDGR:DWHU&RQV'LVWULFW    /DULPHU&RXQW\3HVW&RQWURO'LVWULFW     727$/    RIXSWR )LIW\  0LOOV %DVHGRQWKHSURSHUW\¶VLQFOXVLRQLQWKHPHWURSROLWDQGLVWULFWDQDYHUDJHKRPHVDOHVSULFHRI FRXOGUHVXOWLQ$'',7,21$/DQQXDOSURSHUW\WD[HVXSWR  7KHQH[WSDJHSURYLGHVH[DPSOHVRIHVWLPDWHGWRWDODQQXDOSURSHUW\WD[HVWKDWFRXOGEHGXHRQWKLV SURSHUW\ILUVWLIORFDWHGRXWVLGHWKHPHWURSROLWDQGLVWULFWDQGQH[WLIORFDWHGZLWKLQWKHPHWURSROLWDQ GLVWULFW  Note: property that is not within a metropolitan district would not pay the ADDITIONAL amount.  7KHPHWURSROLWDQGLVWULFWERDUGFDQEHUHDFKHGDVIROORZV  1RUWKILHOG0HWURSROLWDQ'LVWULFW1RBB &2:+,7(%($5$1.(/(7$1$.$ :$/'521 $WWHQWLRQ5REHUW*5RJHUV (&RPPRQV$YH6XLWH &HQWHQQLDO&2 3KRQH <RXPD\ZLVKWRFRQVXOWZLWK  WKH/DULPHU&RXQW\$VVHVVRU¶V2IILFHWRGHWHUPLQHWKHVSHFLILF DPRXQW RIPHWURSROLWDQGLVWULFWWD[HV FXUUHQWO\ GXH RQ WKLV SURSHUW\ DQG   WKHPHWURSROLWDQ GLVWULFWERDUGWRGHWHUPLQHWKHKLJKHVWSRVVLEOHDPRXQWRIPHWURSROLWDQGLVWULFWSURSHUW\WD[HVWKDW FRXOGEHDVVHVVHGRQWKLVSURSHUW\  7DUJHWHG XVHV IRU WKH FRPPHUFLDOVSDFHLQFOXGHDGD\FDUHFHQWHUFRIIHHVKRSDQGELNHUHSDLUVKRS1HLWKHUDPHQLW\LV UHTXLUHG E\ WKH &LW\ DQG ERWK DUH FDWHJRUL]HG DV H[WUDRUGLQDU\ FRVWV WKDW WKH GHYHORSPHQW LV LQFXUULQJIRUWKHEHQHILWRIWKHUHVLGHQWVRI1RUWKILHOGDQGWKHFRPPXQLW\DWODUJH6HHUHQGHULQJV RIWKHFOXEKRXVHDQGWKHPL[HGXVHEXLOGLQJEHORZ    7KH DPRXQW RI RXWGRRU VSDFH JUHDWO\ LQFUHDVHV WKH DPRXQW RI ODQGVFDSLQJ UHTXLUHG FUHDWLQJDGHYHORSPHQWFKDOOHQJHEHFDXVHSURIRUPDUHYHQXHLVORVWGXHWRERWKORVWXQLWVDQG LQFUHDVHGODQGVFDSLQJFRVWV0HWURSROLWDQ'LVWULFWILQDQFLQJWRROVKHOSPLWLJDWHWKLVFKDOOHQJHDQG HQDEOHWKHGHOLYHU\RIHQKDQFHGOLYDELOLW\DQGDGHVLUDEOHGHILQLQJQHZXUEDQLVWFRPPXQLW\QHDU 'RZQWRZQ)RUW&ROOLQV7KH0HWURSROLWDQ'LVWULFWVWUXFWXUHLVDOVRDPRUHHIILFLHQWYHKLFOHIRU PDLQWDLQLQJWKHODQGVFDSLQJDQGRSHQVSDFHWKDQDFRPPRQLQWHUHVWRZQHUVKLSDVVRFLDWLRQ 7KHSURMHFWZLOOIRFXVRQDOOH\ORDGHGXQLWVZKLFKLVDPDMRUWHQDQWRI1HZ8UEDQLVP SODQQLQJYDOXHVDQGWHFKQLTXHV5HVLGHQWVQRWVLWXDWHGRQULJKWRIZD\VZLOOIDFHODQGVFDSHGRSHQ VSDFHDVZHOO$OOH\ORDGHGSURGXFWUHVXOWVLQDIDUVXSHULRUDHVWKHWLFEHQHILWWRLWVUHVLGHQWVWKDQ LQ D FRGHPLQLPXP SURMHFW EXW WKHUH DUH LQFUHDVHG FRVWV DVVRFLDWHG ZLWK WKLV GHVLJQDQGWKH SURSRVHGVWUXFWXUHZLOOKHOSILOOWKDWIXQGLQJJDS7KH0HWURSROLWDQ'LVWULFWVWUXFWXUHLVDOVRD PXFKPRUHHIILFLHQWYHKLFOHWRPDLQWDLQWKHVHDOOH\VWKDQDFRPPRQLQWHUHVWRZQHUVKLSDVVRFLDWLRQ ZRXOGEH  5HJLRQDO7UDLO 5DWKHUWKDQVLPSO\GHVLJQDWLQJDQRQVLWHHDVHPHQWIRUWKHIXWXUHWUDLOFRQVWUXFWLRQ E\WKH&LW\1RUWKILHOGSODQVWRILQDQFHDQGGHOLYHUWKHRQVLWH5HJLRQDO7UDLODVZHOODVWKHRII VLWHSHGHVWULDQFRQQHFWLRQIRUWKHQRUWKHDVWHUQSRUWLRQXSWRWKHLQWHUVHFWLRQDW/HPD\$YHQXHDQG &RQLIHU6WUHHW7KHVLWHZLOODOVRIHDWXUHEXIIHUHGELNHODQHVDQGZLGHUWKDQUHTXLUHGVLGHZDONV *LYHQ1RUWKILHOG¶VSUR[LPLW\WRPDQ\HPSOR\PHQWFHQWHUVDVZHOODVGRZQWRZQ)RUW&ROOLQVWKH LPPHGLDWH FRQVWUXFWLRQ RI WKH 5HJLRQDO 7UDLO ZLOO JLYH RXU UHVLGHQWV DQG WKH VXUURXQGLQJ FRPPXQLW\ HQKDQFHG SHGHVWULDQ DFFHVV WKXV UHGXFLQJ WKH QHHG IRU DXWRPRELOH WULSV 7KH 0HWURSROLWDQ'LVWULFW6WUXFWXUHHQDEOHVWKH5HJLRQDO7UDLOWREHEXLOWFRQFXUUHQWO\ZLWKYHUWLFDO FRQVWUXFWLRQDQGIUHHVWKH&LW\WRDOORFDWHIXQGVWKDWZRXOGKDYHEHHQXVHGWRFRQVWUXFWWKHWUDLOWR RWKHUYDOXDEOHSURMHFWV    2II6LWH6HZHU,PSURYHPHQWV 7KURXJKWKH0HWURSROLWDQ'LVWULFWVWUXFWXUH1RUWKILHOGLVDEOHWRDGYDQFHIXQGVWR LPSURYHDGLODSLGDWHGRIIVLWHVHZHUOLQHDWWKHRQVHWRIWKHSURMHFWDQGSURYLGHLPSURYHGVHZHU VHUYLFHWR1RUWKILHOGDQGVXUURXQGLQJQHLJKERUKRRGVZKHQWKHLPSURYHPHQWVDUHQHHGHGDOORZLQJ WKH&LW\WRUHLPEXUVHDSRUWLRQRIWKRVHH[SHQGLWXUHVDWDIXWXUHGDWH1RUWKILHOGSODQVWRUHSODFH DQGXSVL]H WKH VHZHU OLQH IURP9LQH'ULYHDURXQG$OWD9LVWDDQGDORQJDSRUWLRQRI/HPD\ $YHQXH7KLVDPRXQWVWROLQHDUIHHWRIVHZHUOLQH*LYHQWKH&LW\ VFDSLWDOLPSURYHPHQWV VFKHGXOHLWLVXQOLNHO\WKDWWKDWD&LW\FRQVWUXFWHGOLQHXSVL]LQJSURMHFWDWWKLVORFDWLRQFRXOGEH FRPSOHWHGXQWLOORQJDIWHU1RUWKILHOGLVEXLOW1RUWKILHOGDQGWKH0HWURSROLWDQ'LVWULFWVWUXFWXUH ZRXOGPDNHLWSRVVLEOHWRILQDQFHDQGUHSODFHWKHIDLOLQJVHZHUOLQHGXULQJKRUL]RQWDOFRQVWUXFWLRQ SURYLGLQJLPPHGLDWHSXEOLFEHQHILWWRWKHFRPPXQLW\  (QYLURQPHQWDO&RQVHUYDWLRQ %RUGHULQJWKH/DNH&DQDO:HWODQGV1RUWKILHOG¶VGHVLJQSURWHFWVDQGHQKDQFHVWKLV LPSRUWDQWHFRV\VWHP7KHSURMHFWSURYLGHVDQHQKDQFHGVHWEDFNIURPWKH/DNH&DQDO:HWODQGVWR IXUWKHUSURWHFWWKHPIURPQHZGHYHORSPHQW7KHFRQQHFWLRQVRYHU/DNH&DQDOZLOOEHFRQVWUXFWHG ZLWKORZLPSDFWER[FXOYHUWVDQGDELGHE\DQGH[FHHG$UP\&RUHRI(QJLQHHUVVWDQGDUGVIRU KLVWRULFSURWHFWHGZHWODQGV 1RUWKILHOGZLOOLQFOXGHDSSUR[LPDWHO\DFUHVRISDUNVDQGJUHHQVSDFHVFRYHULQJ DSSUR[LPDWHO\RIWKHHQWLUHSURMHFWDQGIDUH[FHHGLQJ WKH&LW\¶V UHTXLUHPHQWV IRURSHQ VSDFH  7KHVH ODQGVFDSHG DUHDV ZLOO IRFXV RQ ORZZDWHU XVDJH GHVLJQV  ,QLWLDO K\GUR]RQH FDOFXODWLRQV LQGLFDWH1RUWKILHOGZLOOXVHJDOORQVRIZDWHUSHUVTXDUHIRRWZHOOEHORZWKH &LW\¶VOLPLWRIJDOORQVRIZDWHUSHUVTXDUHIRRW F  (QKDQFHG&RPPXQLW\5HVLOLHQF\ 1RUWKILHOGLVORFDWHGZLWKLQWKH&LW\¶V1RUWKVLGH1HLJKERUKRRGV3ODQDUHD2QHRI WKH&LW\¶VJRDOVXQGHUWKDWSODQLVLPSURYLQJVWRUPZDWHUGUDLQDJHIRUWKH'U\&UHHNDQG3RXGUH 5LYHU%DVLQVWRUHPRYHODQGVIURPWKHIORRGSODLQ7KHSURSHUW\ZLWKLQ1RUWKILHOGKDVDKLJKZDWHU WDEOHDQGWKURXJKWKHXVHRIWKH0HWURSROLWDQ'LVWULFWVWUXFWXUHDQGILQDQFLQJWRROVWKHVLWHZRXOG EH GHZDWHUHG XVLQJ D SHUIRUDWHG XQGHUGUDLQ V\VWHP ZKLFK ZLOO IDFLOLWDWH WKH &LW\¶V JRDO RI LPSURYLQJVWRUPZDWHUGUDLQDJHLQWKH'U\&UHHNDQG3RXGUH5LYHU%DVLQV 0RUH VSHFLILFDOO\ 1RUWKILHOG DQWLFLSDWHV LPSOHPHQWLQJ LQILOWUDWLRQ JDOOHULHV DQG XWLOL]LQJERWKEHORZJUDGH6WRUP7HFKFKDPEHUVDQGDUDLQJDUGHQWRHQKDQFHVWRUPZDWHUUXQRII TXDQWLW\DQGTXDOLW\7KHVHIHDWXUHVDUHLQDGGLWLRQWRWKH&LW\¶VVWDQGDUGVWRUPZDWHUGHWHQWLRQ UHTXLUHPHQWV DQGZDWHUTXDOLW\ FDSWXUHYROXPHV7KHLQILOWUDWLRQJDOOHULHVDQGUDLQJDUGHQDUH /RZ,PSDFW'HYHORSPHQW /,' IHDWXUHVWKDWDOORZVHGLPHQWWREHILOWHUHGRXWZKLOHSURYLGLQJ LQILOWUDWLRQ WR SURWHFW WKH HQYLURQPHQW DQG UHGXFH WKH YROXPH RI GHYHORSHG UXQRII  7KHVH PHDVXUHV FRPELQHG ZLWK WKH GHZDWHULQJ HIIRUWV ZLOO PDNH 1RUWKILHOG DQG WKH VXUURXQGLQJ QHLJKERUKRRGVOHVVVXVFHSWLEOHWRIXWXUHIORRGLQJ  &ULWLFDO3XEOLF,QIUDVWUXFWXUH D  &RQVWUXFWLRQRI6XQLJD5RDGDVDQ$UWHULDO5RDG 8QGHU WKH&LW\¶VEXLOGLQJDQG]RQLQJ UXOHV D VWDQGDUGSURMHFWGRHVQRWUHTXLUH UHJLRQDOURDGDFFHVVELVHFWLQJWKHVLWH+RZHYHU1RUWKILHOGLVZLOOLQJWRIXOILOOWKH&LW\¶VUHTXHVW WKDWWKHSURMHFWLQFOXGHDODQHDUWHULDOURDGLQRUGHUWRLPSURYHWKHDFFHVVWRWKHHQWLUHQRUWKHDVW UHJLRQRIWKH&LW\7KLVUHJLRQDOFRQQHFWLRQZLOOUXQIURP5HGZRRG6WUHHWWR/HPD\$YHQXH FRQQHFWLQJWRWKHH[LVWLQJSRUWLRQRI6XQLJD5RDGWRWKHZHVWRIWKHSURMHFW 7KH 0HWURSROLWDQ 'LVWULFW ILQDQFLQJ WRROV ZLOO KHOS HQDEOH WKH FRQVWUXFWLRQ RI 6XQLJD 5RDG DV DQ DUWHULDO URDG IRU WKH &LW\ ZKLFK LV D PXFK PRUH VLJQLILFDQW UHJLRQDO WUDQVSRUWDWLRQ FRQWULEXWLRQ WKDQ LV W\SLFDOO\ GHOLYHUHG E\ SURMHFWV RI 1RUWKILHOG¶V VL]H  7KH 0HWURSROLWDQ 'LVWULFW VWUXFWXUH DQG ILQDQFH WRROV IDFLOLWDWH GHOLYHU\ RI WKLV VWUHWFK RXWFRPH E\ RIIVHWWLQJWKHFRVWVDQGORVVRIGHYHORSDEOHVSDFHWKDW1RUWKILHOGIDFHVE\GHGLFDWLQJLQFUHDVHG  (QHUJ\&RQVHUYDWLRQ 7KH0HWUR'LVWULFWVWUXFWXUHZLOOHQDEOHWKHFRQVWUXFWLRQRIPRUHHQHUJ\HIILFLHQW KRPHV$OOWKHKRPHVDWWKHDWWDLQDEOHSULFHSRLQWZLOOFRPPLWWR+(56UDWLQJVUDQJLQJIURP WR,QFUHDVHGHQHUJ\HIILFLHQWEXLOGLQJPDWHULDOVDQGPHWKRGVZHUHFRQVLGHUHGWRLQFUHDVHWKH HQHUJ\HIILFLHQF\RIWKHKRPHV$FFRUGLQJWRWKH+(56LQGH[WKHVHKRPHVLQ1RUWKILHOGZLOOEH PRUHHQHUJ\ HIILFLHQW WKDQ D VWDQGDUGQHZKRPHDQGPRUHHIILFLHQWWKDQWKH DYHUDJH UHVDOH KRPH /DQGPDUN ZLOO FRQWUDFW ZLWK D JUHHQ HQHUJ\FRQVXOWDQWWRHQVXUHWKH EXLOGLQJVDUHFRQVWUXFWHGDFFRUGLQJWRHQHUJ\HIILFLHQWVWDQGDUGVDQGWKDWRIILFLDO+(56VFRUHVDUH FHUWLILHGXSRQFRPSOHWLRQ7KH+(56UDWLQJVIRUHDFKSURGXFWW\SHDUHDVIROORZV  7KH&LW\GRHVQRWFXUUHQWO\UHTXLUHWKHSURMHFWWRLQFOXGHVRODUSRZHUFDSDELOLW\RU FKDUJLQJVWDWLRQVIRUHOHFWULFYHKLFOHV1RUWKILHOGSODQVWRLQFOXGHVRODUSDQHOVRQWKHXQLW FRQGRPLQLXP EXLOGLQJV DQG WKH FRPPXQLW\ FOXEKRXVH VXIILFLHQW HQRXJK WR SURYLGH XS WR  NLORZDWWVRISRZHUSHUEXLOGLQJ7KHVHVRODUSDQHOVZLOOSURYLGHWKHSRZHUQHHGHGIRUWKHFRPPRQ DUHDVSDFHVLQFOXGLQJHOHYDWRUV7KHUHQHZDEOHHQHUJ\SURYLGHGE\WKHVRODUSDQHOVZLOODOVR GHFUHDVHWKHFRPPRQVSDFHPDLQWHQDQFHEXUGHQIRUUHVLGHQWVLQWKHFRQGRPLQLXPEXLOGLQJV 1RUWKILHOGZLOODOVRGHOLYHUD9RXWOHWLQHYHU\JDUDJHWRSURYLGHDSODFHIRUWKH HOHFWULFYHKLFOHIDVWFKDUJLQJVWDWLRQVDQGIXUWKHUHQFRXUDJHUHVLGHQWVWRGULYHHFRIULHQGO\FDUV ,QDGGLWLRQWRWKHRXWOHWV1RUWKILHOGZLOOSURYLGHHOHFWULFDOYHKLFOHFKDUJLQJVWDWLRQVDWSDUNLQJ ORFDWLRQVWKURXJKRXWWKHSURMHFWZKLFKZLOOEHDYDLODEOHWRUHVLGHQWVDQGWKHJUHDWHUFRPPXQLW\ 7KHVHFKDUJLQJVWDWLRQVDQGHOHFWULFDORXWOHWVGHPRQVWUDWHWKDW1RUWKILHOGLVDQHQYLURQPHQWDOO\ IULHQGO\FRPPXQLW\DQGHQFRXUDJHVWKHXVHRIHOHFWULFYHKLFOHVWRKHOSUHGXFHJUHHQKRXVHJDV HPLVVLRQV  $IIRUGDEOH DQG DWWDLQDEOH KRXVLQJ LQ 1RUWKILHOG¶V FHQWUDO ORFDWLRQ ZRXOG SURYLGH DQ H[WUDRUGLQDU\EHQHILWWRWKH&LW\DQGLWVUHVLGHQWV1RUWKILHOGLVORFDWHGZLWKLQZDONLQJDQGRU ELNLQJGLVWDQFHWRVRPHRIWKHODUJHVWHPSOR\PHQWKXEVLQWKH&LW\LQFOXGLQJ&LW\RI)RUW&ROOLQV 0XQLFLSDO 2IILFHV &RORUDGR 6WDWH 8QLYHUVLW\ :RRGZDUG DQG 1HZ %HOJLXP %UHZLQJ 1RUWKILHOG VSUR[LPLW\WRWKHVHKXEVDQGLWVDIIRUGDEOHDQGDWWDLQDEOHSULFHSRLQWVVHWWKHSURMHFW DSDUWIURPRWKHUUHFHQWUHVLGHQWLDOGHYHORSPHQWVLQ)RUW&ROOLQV7KURXJK1RUWKILHOGWKH&LW\ZLOO DQGVXUURXQGLQJ/DULPHU&RXQW\IDFHDVLJQLILFDQW DIIRUGDEOHDQGDWWDLQDEOHKRXVLQJVKRUWDJH6LWXDWHGRQRQHRIWKHODVWXQGHYHORSHGSDUFHOVRIODQG ZLWKLQ ZDONLQJ GLVWDQFH RI 2OG 7RZQ )RUW &ROOLQV 1RUWKILHOG 0HWURSROLWDQ 'LVWULFW 1RV  ³1RUWKILHOG´  ZLOO FUHDWHDQDIIRUGDEOHDQGDWWDLQDEOHQHLJKERUKRRGZRYHQ LQWR WKH IDEULF RI FHQWUDO)RUW&ROOLQVDQGDGYDQFLQJWKH&LW\¶VYLVLRQIRUWKHIXWXUH  7KH 0HWURSROLWDQ 'LVWULFW VWUXFWXUH ZLOO SURYLGH WKH ILQDQFLQJ PHFKDQLVPV WKDW PDNH DWWDLQLQJWKH&LW\¶VVWUHWFKRXWFRPHVDQGGHYHORSPHQWREMHFWLYHVSRVVLEOH0HWURSROLWDQ'LVWULFW ILQDQFLQJZRXOGPLWLJDWHLQFUHDVHGIURQWHQGFRVWVRIPRGHUQGHYHORSPHQWPHDQLQJLQFUHDVHG FRVWVDUHQRWSDVVHGGLUHFWO\WRUHVLGHQWVDWWKHSRLQWRIVDOHDQGWKXVNHHSLQJKRXVLQJXQLWSULFHV LQWKHDIIRUGDEOHDQGDWWDLQDEOHUDQJH1RUWKILHOGZLOOGHOLYHURQWKHVH&LW\REMHFWLYHV$IIRUGDEOH DQG$WWDLQDEOH+RXVLQJ(QYLURQPHQWDO6XVWDLQDELOLW\&ULWLFDO3XEOLF,QIUDVWUXFWXUHDQG6PDUW *URZWK0DQDJHPHQW   $IIRUGDEOHDQG$WWDLQDEOH+RXVLQJ 7KHVKRUWDJHRIDIIRUGDEOHDQGDWWDLQDEOHKRXVLQJLQ)RUW&ROOLQVLVRQHRIWKH&LW\¶VPRVW SUHVVLQJFRQFHUQV$QQXDOKRXVLQJVWDUWVLQ)RUW&ROOLQVSULFHGXQGHUKDYHGURSSHG LQWKHSDVW\HDU1RUWKILHOGSODQVWRFUHDWHKRXVLQJIRUWKHFRPPXQLW\DWSULFHVWKDWDUHZHOOEHORZ DYHUDJH IRU WKH DUHD  7KH 0HWURSROLWDQ 'LVWULFW VWUXFWXUH LV D FULWLFDO WRRO IRU IDFLOLWDWLQJ WKH                                                           15  13                                                        10 7                                                                                                                                                                                                             BBBBBBB BBBBBBBB BBBBBBB    &10')LQ3ODQ 1563)LQ3ODQ,*5HIJ 3UHSDUHGE\'$'DYLGVRQ &R 'UDIW)RUGLVFXVVLRQSXUSRVHVRQO\ 3                                                                                              >5HI GE\VHU @                                                                                                                                                                                                                                                                                                            BBBBBBBBB BBBBBBBBB BBBBBBBBB BBBBBBBBB BBBBBBBBB BBBBBBBBB BBBBBBBBB        >&$SUQUVS&@ >&$SULJVS&@ > @(VWLPDWHGEDODQFH WEG  &10')LQ3ODQ 1563)LQ3ODQ,*5HIJ 3UHSDUHGE\'$'DYLGVRQ &R 'UDIW)RUGLVFXVVLRQSXUSRVHVRQO\ 2 $5($6 1 :( 6 '5$:1%< '$7( 6&$/( + +'6352- 6+((7 2) 1257+),(/' 67250'5$,1$*(0$3    .5%  (   6&$/(      ŽŶŶĞĐƚŽƌ>ŽĐĂů^ƚƌĞĞƚ;ϯϲΖ^ĞĐƚŝŽŶͿ KĨĨͲ^ŝƚĞ^ƵŶŝŐĂZĚϰͲůĂŶĞƌƚĞƌŝĂů;ϴϯΖ^ĞĐƚŝŽŶͿ ^ƚƌĞĞƚ>ŝŐŚƚŝŶŐ ^ƵďƚŽƚĂů ^ƚŽƌŵƌĂŝŶĂŐĞ/ŵƉƌŽǀĞŵĞŶƚƐ ZW^ƚŽƌŵ^ĞǁĞƌ ^ƵďƚŽƚĂů ϲΗtĂƚĞƌůŝŶĞ ϭϬΗtĂƚĞƌůŝŶĞ ϭϮΗtĂƚĞƌůŝŶĞ hƚŝůŝƚLJŽƌŝŶŐƐ ZĂǁtĂƚĞƌZĞƋƵŝƌĞŵĞŶƚƐ ^ƵďƚŽƚĂů ^ĂŶŝƚĂƌLJ^ĞǁĞƌ/ŵƉƌŽǀĞŵĞŶƚƐ ϴΗ^ĂŶŝƚĂƌLJ^ĞǁĞƌ ϭϬΗ^ĂŶŝƚĂƌLJ^ĞǁĞƌ džŝƐƚŝŶŐϭϴΗƚŽϮϰΗ^ĂŶŝƚĂƌLJ^ĞǁĞƌhƉƐŝnjĞ ^ƵďƚŽƚĂů ϲΗtĂƚĞƌůŝŶĞ ĂƌƚŚǁŽƌŬ;ĐƵƚͬĨŝůůͬƉůĂĐĞͿ ƌŽƐŝŽŶŽŶƚƌŽůͬdƌĂĨĨŝĐŽŶƚƌŽů ZŽĂĚǁĂLJ/ŵƉƌŽǀĞŵĞŶƚƐ EŽƚĞ͗YƵĂŶƚŝƚŝĞƐŝŶƚŚŝƐƐƵďĐĂƚĞŐŽƌLJƌĞĨůĞĐƚƉƵďůŝĐƉŽƌƚŝŽŶŽĨƐŝƚĞ;ϴϬ͘ϱйͿ 'ƌĂĚŝŶŐͬDŝƐĐĞůůĂŶĞŽƵƐ DŽďŝůŝnjĂƚŝŽŶͬ'ĞŶĞƌĂůŽŶĚŝƚŝŽŶƐ ^/Wh>//DWZKsDEdK^d^&KZEKZd,&/>DdZK/^dZ/dEK^͘ϭͲϯ dŚĞƵŶŝƚƐĂŶĚĐŽƐƚďĞůŽǁĂƌĞďĞƐƚĂƐƐƵŵƉƚŝŽŶƐďĂƐĞĚŽŶƚŚĞůĞǀĞůŽĨŝŶĨŽƌŵĂƚŝŽŶĂǀĂŝůĂďůĞĂƚƚŚŝƐƚŝŵĞŝŶĚĞƐŝŐŶ͘^ƚƌĞĞƚƐĞĐƚŝŽŶŝŶƌĞĨĞƌĞŶĐĞƚŽ>h^^ ŽŶŶĞĐƚŽƌ>ŽĐĂůƐƚƌĞĞƚƐĞĐƚŝŽŶ͕ĂŶĚƉĂǀĞŵĞŶƚƐĞĐƚŝŽŶŝŶƌĞĨĞƌĞŶĐĞƚŽŐĞŽƚĞĐŚƌĞƉŽƌƚ WƵďůŝĐ/ŵƉƌŽǀĞŵĞŶƚƐ ĞƐĐƌŝƉƚŝŽŶ ŽŶŶĞĐƚŽƌ>ŽĐĂů^ƚƌĞĞƚ;ϯϲΖ^ĞĐƚŝŽŶͿ KĨĨͲ^ŝƚĞ^ƵŶŝŐĂZĚϰͲůĂŶĞƌƚĞƌŝĂů;ϴϯΖ^ĞĐƚŝŽŶͿ ^ƚƌĞĞƚ>ŝŐŚƚŝŶŐ DĞƚƌŽŝƐƚƌŝĐƚKǁŶĞĚƌŝǀĞƐ;ϮϲΖ^ĞĐƚŝŽŶͿ ^ƵďƚŽƚĂů ^ƵďƚŽƚĂů 6RXWKHDVW&RUQHURI6HFWLRQ 7RZQVKLS1RUWK5DQJH:HVW 1ƒ ( EDVLVRIEHDULQJV (DVWOLQHRIWKH6RXWKHDVW   RI6HFWLRQ (DVW &RUQHURI6HFWLRQ 7RZQVKLS1RUWK5DQJH:HVW 1ƒ : 32,172) %(*,11,1*' 6ƒ (  1ƒ (  1ƒ :  6ƒ :  3?3URMHFW???GZJ?GB'GZJ0D\DP 2IILFH,QIR#SOVFRUSRUDWLRQFRP 3/6&RUSRUDWLRQ /RYHODQG&RORUDGR :HVWWK6WUHHW  'DWH 5HYLVLRQV 3DUW\&KLHI 6XUYH\7HFK 3URM0DQDJHU )LHOG'DWH 3UHSDUHGIRU 3URMHFW 127,&($FFRUGLQJWR&RORUDGRODZ\RXPXVWFRPPHQFHDQ\OHJDO DFWLRQEDVHGXSRQDQ\GHIHFWLQWKLVVXUYH\ZLWKLQWKUHH\HDUVDIWHU\RX ILUVWGLVFRYHUVXFKGHIHFW,QQRHYHQWPD\DQ\DFWLRQEDVHGXSRQDQ\ GHIHFWLQWKLVVXUYH\EHFRPPHQFHGPRUHWKDQWHQ\HDUVIURPWKHGDWH RIWKHFHUWLILFDWLRQVKRZQKHUHRQ 'HVFULSWLRQ([KLELW 0%6 0'* 1$ 1$ +LJKODQG'HYHORSPHQW6HUYLFHV,QF ' Detail 1" = 50' 6FDOHLQFK IHHW      see sheet 1 for description sheet 2 of 2 :IRUDGLVWDQFHRIIHHWDORQJVDLG(DVWOLQH WKHQFH6ƒ (IRUDGLVWDQFHRIIHHWWRDSRLQWRQWKHDIRUHVDLG:HVWHUO\ULJKWRIZD\OLQHRI1RUWK/HPD\ $YHQXH WKHQFH1ƒ (IRUDGLVWDQFHRIIHHWDORQJVDLG:HVWHUO\ULJKWRIZD\OLQHWRWKH3RLQWRI%HJLQQLQJ $1'WKDWSRWLRQGHVFULEHGDVIROORZV &200(1&,1*DWWKHDIRUHVDLG3RLQW$ WKHQFH1ƒ :IRUDGLVWDQFHRIIHHWWRWKH32,172)%(*,11,1*' WKHQFH1ƒ :IRUDGLVWDQFHRIIHHW WKHQFH1ƒ (IRUDGLVWDQFHRIIHHW WKHQFH6ƒ (IRUDGLVWDQFHRIIHHW WKHQFH6ƒ :IRUDGLVWDQFHRIIHHWWRWKH3RLQWRI%HJLQQLQJ' &RQWDLQLQJDFUHVPRUHRUOHVV :ULWWHQE\0%U\DQ6KRUW&RORUDGR3/6 see sheet 2 for exhibit sheet 1 of 2             %HDULQJ 1ƒ : 6ƒ ( 1ƒ ( 6ƒ ( 1ƒ : 1ƒ ( 6ƒ ( 6ƒ : 1ƒ : 1ƒ ( 6ƒ ( 6ƒ : &XUYH7DEOH &XUYH & & & /HQJWK    5DGLXV    'HOWD ƒ  ƒ  ƒ  &KRUG%HDULQJ 1ƒ : 1ƒ ( 1ƒ ( &KRUG/HQJWK    1ƒ : 1ƒ : / / / / / / / / 32,172) %(*,11,1*' 32,172) %(*,11,1*' (DVW &RUQHURI6HFWLRQ 7RZQVKLS1RUWK5DQJH:HVW 3?3URMHFW???GZJ?GB'GZJ0D\DP 2IILFH,QIR#SOVFRUSRUDWLRQFRP 3/6&RUSRUDWLRQ /RYHODQG&RORUDGR :HVWWK6WUHHW  'DWH 5HYLVLRQV 3DUW\&KLHI 6XUYH\7HFK 3URM0DQDJHU )LHOG'DWH 3UHSDUHGIRU 3URMHFW 127,&($FFRUGLQJWR&RORUDGRODZ\RXPXVWFRPPHQFHDQ\OHJDO DFWLRQEDVHGXSRQDQ\GHIHFWLQWKLVVXUYH\ZLWKLQWKUHH\HDUVDIWHU\RX ILUVWGLVFRYHUVXFKGHIHFW,QQRHYHQWPD\DQ\DFWLRQEDVHGXSRQDQ\ GHIHFWLQWKLVVXUYH\EHFRPPHQFHGPRUHWKDQWHQ\HDUVIURPWKHGDWH RIWKHFHUWLILFDWLRQVKRZQKHUHRQ 'HVFULSWLRQ([KLELW 0%6 0'* 1$ 1$ +LJKODQG'HYHORSPHQW6HUYLFHV,QF ' 6FDOHLQFK IHHW      Detail 1" = 50' see sheet 1 for description sheet 2 of 2 WRDSRLQW RIWDQJHQF\ WKHQFH6ƒ (IRUDGLVWDQFHRIIHHWWRDSRLQWRQWKHDIRUHVDLG:HVWHUO\ULJKWRIZD\OLQHRI1RUWK/HPD\ $YHQXH WKHQFH6ƒ :IRUDGLVWDQFHRIIHHWDORQJVDLG:HVWHUO\ULJKWRIZD\OLQHWRWKH3RLQWRI%HJLQQLQJ (;&(37WKDWSRUWLRQGHVFULEHGDVIROORZV &200(1&,1*DWWKHDIRUHVDLG3RLQW$ WKHQFH1ƒ :IRUDGLVWDQFHRIIHHWWRWKH32,172)%(*,11,1*' WKHQFH1ƒ :IRUDGLVWDQFHRIIHHW WKHQFH1ƒ (IRUDGLVWDQFHRIIHHW WKHQFH6ƒ (IRUDGLVWDQFHRIIHHW WKHQFH6ƒ :IRUDGLVWDQFHRIIHHWWRWKH3RLQWRI%HJLQQLQJ' $/62(;&(37WKDWSRWLRQGHVFULEHGDVIROORZV &200(1&,1*DWWKHDIRUHVDLG3RLQW$ WKHQFH1ƒ :IRUDGLVWDQFHRIIHHWWRWKH32,172)%(*,11,1*' WKHQFH1ƒ :IRUDGLVWDQFHRIIHHW WKHQFH1ƒ (IRUDGLVWDQFHRIIHHW WKHQFH6ƒ (IRUDGLVWDQFHRIIHHW WKHQFH6ƒ :IRUDGLVWDQFHRIIHHWWRWKH3RLQWRI%HJLQQLQJ' &RQWDLQLQJDFUHVPRUHRUOHVV :ULWWHQE\0%U\DQ6KRUW&RORUDGR3/6 +RZHYHUWKH&LW\DQGWKH'LVWULFWVPD\LQFOXGHVXFKDGGLWLRQDOGHWDLOV WHUPVDQGFRQGLWLRQVDVWKH\GHHPQHFHVVDU\LQFRQQHFWLRQZLWKWKH3URMHFWDQGWKHFRQVWUXFWLRQ DQGIXQGLQJRIWKH3XEOLF,PSURYHPHQWVDQGWKH3XEOLF%HQHILWV(DFKRIWKH'LVWULFWV¶%RDUGV VKDOODSSURYHWKH,*$DWWKHLUILUVWERDUGPHHWLQJXQOHVVDJUHHGRWKHUZLVHE\WKH&LW\0DQDJHU (QWHULQJLQWRWKLV,*$LVDSUHFRQGLWLRQWRHDFKRIWKH'LVWULFWVLVVXLQJDQ\'HEWRULPSRVLQJDQ\ 'HEW0LOO/HY\2SHUDWLQJ0LOO/HY\RU)HHIRUWKHSD\PHQWRI'HEWXQGHUWKLV6HUYLFH3ODQ,Q DGGLWLRQIDLOXUHRIDQ\RIWKH'LVWULFWVWRHQWHULQWRWKH,*$DVUHTXLUHGKHUHLQVKDOOFRQVWLWXWHD PDWHULDOPRGLILFDWLRQRIWKLV6HUYLFH3ODQDQGVXEMHFWWKH'LVWULFWWRWKHVDQFWLRQVLQ6HFWLRQ;9,, RIWKLV6HUYLFH3ODQ7KH&LW\DQGWKH'LVWULFWVPD\DPHQGWKH,*$IURPWLPHWRWLPHSURYLGHG VXFKDPHQGPHQWLVQRWLQFRQIOLFWZLWKDQ\SURYLVLRQRIWKLV6HUYLFH3ODQ XIX. CONCLUSION ,WLVVXEPLWWHGWKDWWKLV6HUYLFH3ODQDVUHTXLUHGE\&566HFWLRQ  HVWDEOLVKHV WKDW $ 7KHUHLVVXIILFLHQWH[LVWLQJDQGSURMHFWHGQHHGIRURUJDQL]HGVHUYLFHLQWKH6HUYLFH $UHDWREHVHUYHGE\WKH'LVWULFWV % 7KHH[LVWLQJVHUYLFHLQWKH6HUYLFH$UHDWREHVHUYHGE\WKH'LVWULFWVLVLQDGHTXDWH IRUSUHVHQWDQGSURMHFWHGQHHGV & 7KH 'LVWULFWV DUH FDSDEOH RI SURYLGLQJ HFRQRPLFDODQGVXIILFLHQWVHUYLFH WR WKH 6HUYLFH$UHDDQG ' 7KH6HUYLFH$UHDGRHVKDYHDQGZLOOKDYHWKHILQDQFLDODELOLW\WRGLVFKDUJHWKH SURSRVHGLQGHEWHGQHVVRQDUHDVRQDEOHEDVLV XX. RESOLUTION OF APPROVAL 7KH'LVWULFWVDJUHHWRLQFRUSRUDWHWKH&LW\&RXQFLO¶V UHVROXWLRQ DSSURYLQJ WKLV6HUYLFH 3ODQLQFOXGLQJDQ\FRQGLWLRQVRQDQ\VXFKDSSURYDOLQWRWKHFRS\RIWKH6HUYLFH3ODQSUHVHQWHG WRWKH'LVWULFW&RXUWIRUDQGLQ/DULPHU&RXQW\&RORUDGR \HDUVIURPWKHGDWHRIWKH&LW\&RXQFLO¶VDSSURYDORIWKLV 6HUYLFH3ODQQRDJUHHPHQWFRQWHPSODWHGXQGHU6HFWLRQ,9%RIWKLV6HUYLFH3ODQKDVEHHQHQWHUHG LQWRE\WKH&LW\ZLWKDQ\RIWKH'LVWULFWVDQGRUDQ\'HYHORSHUGHVSLWHWKHSDUWLHVFRQGXFWLQJJRRG IDLWKQHJRWLDWLRQVDWWHPSWLQJWRGRVRWKH&LW\PD\RSWWRSXUVXHWKHUHPHGLHVDYDLODEOHWRLWXQGHU &566HFWLRQ  LQRUGHUWRFRPSHOWKH'LVWULFWVWRGLVVROYHLQDSURPSWDQGRUGHUO\ PDQQHU,QVXFKHYHQW L WKHOLPLWHGSXUSRVHVDQGSRZHUVRIWKH'LVWULFWVDVDXWKRUL]HGKHUHLQ VKDOO DXWRPDWLFDOO\ WHUPLQDWH DQG EH H[SUHVVO\ OLPLWHG WR WDNLQJ RQO\ WKRVH DFWLRQV WKDW DUH UHDVRQDEO\QHFHVVDU\WRGLVVROYH LL WKH%RDUGRIHDFKRIWKH'LVWULFWVZLOOEHGHHPHGWRKDYH DJUHHG ZLWK WKH &LW\ UHJDUGLQJ LWV GLVVROXWLRQ ZLWKRXW DQ HOHFWLRQ SXUVXDQW WR &56 †   E  LLL WKH'LVWULFWVVKDOOWDNHQRDFWLRQWRFRQWHVWRULPSHGHWKHGLVVROXWLRQRIWKH'LVWULFWV DQGVKDOODIILUPDWLYHO\DQGGLOLJHQWO\FRRSHUDWHLQVHFXULQJWKHILQDOGLVVROXWLRQRIWKH'LVWULFWV DQG LY  VXEMHFW WR WKH VWDWXWRU\ UHTXLUHPHQWV RI WKH 6SHFLDO 'LVWULFW $FW WKH 'LVWULFWV VKDOO WKHUHXSRQGLVVROYH XVII. SANCTIONS 6KRXOGDQ\RIWKH'LVWULFWVXQGHUWDNHDQ\DFWZLWKRXWREWDLQLQJSULRU&LW\&RXQFLODSSURYDO RUFRQVHQWRU&LW\0DQDJHUDSSURYDORUFRQVHQWDVUHTXLUHGLQWKLV6HUYLFH3ODQWKDWFRQVWLWXWHVD PDWHULDOPRGLILFDWLRQWRWKLV6HUYLFH3ODQUHTXLULQJD6HUYLFH3ODQ$PHQGPHQWDVSURYLGHGKHUHLQ RUXQGHUWKH6SHFLDO'LVWULFW$FWRUWKDWGRHVQRWRWKHUZLVHFRPSO\ZLWKWKHSURYLVLRQVRIWKLV 6HUYLFH3ODQWKH&LW\&RXQFLOPD\LPSRVHRQH  RUPRUHRIWKHIROORZLQJVDQFWLRQVDVLWGHHPV DSSURSULDWH $ ([HUFLVHDQ\DSSOLFDEOHUHPHG\XQGHUWKH6SHFLDO'LVWULFW$FW GD\SHULRGXQGHUDQ\'HEWLQVWUXPHQW  $Q\ LQDELOLW\ RI WKH'LVWULFWWRSD\ LWV REOLJDWLRQV DV WKH\ FRPH GXH LQ DFFRUGDQFHZLWKWKHWHUPVRIVXFKREOLJDWLRQVZKLFKFRQWLQXHEH\RQGDQLQHW\  GD\SHULRG E. Failure to Submit. ,QWKHHYHQWWKHDQQXDOUHSRUWLVQRWWLPHO\UHFHLYHGE\WKH&LW\&OHUNRULVQRWIXOO\ UHVSRQVLYHQRWLFHRIVXFKGHIDXOWVKDOOEHJLYHQWRWKH'LVWULFW¶V%RDUGDWLWVODVWNQRZQDGGUHVV 7KHIDLOXUHRIWKH'LVWULFWWRILOHWKHDQQXDOUHSRUWZLWKLQIRUW\ILYH  GD\VRIWKHPDLOLQJRI VXFKGHIDXOWQRWLFHE\WKH&LW\&OHUNPD\FRQVWLWXWHDPDWHULDOPRGLILFDWLRQRIWKH6HUYLFH3ODQ DWWKHGLVFUHWLRQRIWKH&LW\0DQDJHU XIV. SERVICE PLAN AMENDMENTS 7KLV6HUYLFH3ODQLVJHQHUDOLQQDWXUHDQGGRHVQRWLQFOXGHVSHFLILFGHWDLOLQVRPHLQVWDQFHV 7KH6HUYLFH3ODQKDVEHHQGHVLJQHGZLWKVXIILFLHQWIOH[LELOLW\WRHQDEOHWKH'LVWULFWVWRSURYLGH UHTXLUHGLPSURYHPHQWVVHUYLFHVDQGIDFLOLWLHVXQGHUHYROYLQJFLUFXPVWDQFHVZLWKRXWWKHQHHGIRU QXPHURXVDPHQGPHQWV0RGLILFDWLRQRIWKHJHQHUDOW\SHVRILPSURYHPHQWVDQGIDFLOLWLHVPDNLQJ XSWKH3XEOLF,PSURYHPHQWVDQGFKDQJHVLQSURSRVHGFRQILJXUDWLRQVORFDWLRQVRUGLPHQVLRQVRI WKH3XEOLF,PSURYHPHQWVVKDOOEHSHUPLWWHGWRDFFRPPRGDWHGHYHORSPHQWQHHGVFRQVLVWHQWZLWK WKHWKHQFXUUHQW$SSURYHG'HYHORSPHQW3ODQVIRUWKH3URMHFWDQGDQ\DJUHHPHQWDSSURYHGE\WKH &LW\&RXQFLOSXUVXDQWWRWKH6HFWLRQ,9%RIWKLV6HUYLFH3ODQ$Q\DFWLRQRIRQHRUPRUHRIWKH 'LVWULFWV ZKLFK LV D PDWHULDO PRGLILFDWLRQ RI WKLV 6HUYLFH 3ODQ UHTXLULQJ D 6HUYLFH 3ODQ $PHQGPHQWDVSURYLGHGLQLQ6HFWLRQ;9RIWKLV6HUYLFH3ODQRUWKDWGRHVQRWFRPSO\ZLWKDQ\ SURYLVLRQRIWKLV6HUYLFH3ODQVKDOOEHGHHPHGWREHDPDWHULDOPRGLILFDWLRQWRWKLV6HUYLFH3ODQ XQOHVVRWKHUZLVHH[SUHVVO\SURYLGHGLQWKLV6HUYLFH3ODQ$OORWKHUGHSDUWXUHVIURPWKHSURYLVLRQV RIWKLV6HUYLFH3ODQVKDOOEHFRQVLGHUHGRQDFDVHE\FDVHEDVLVDVWRZKHWKHUVXFKGHSDUWXUHVDUH DPDWHULDOPRGLILFDWLRQXQGHUWKLV6HUYLFH3ODQRUWKH6SHFLDO'LVWULFW$FW XV. MATERIAL MODIFICATIONS 0DWHULDOPRGLILFDWLRQVWRWKLV6HUYLFH3ODQPD\EHPDGHRQO\LQDFFRUGDQFHZLWK&56 6HFWLRQDVD6HUYLFH3ODQ$PHQGPHQW1RPRGLILFDWLRQVKDOOEHUHTXLUHGIRUDQDFWLRQ RIWKH'LVWULFWVWKDWGRHVQRWPDWHULDOO\GHSDUWIURPWKHSURYLVLRQVRIWKLV6HUYLFH3ODQXQOHVV RWKHUZLVHSURYLGHGLQWKLV6HUYLFH3ODQ 'HSDUWXUHVIURPWKH6HUYLFH3ODQWKDWFRQVWLWXWHDPDWHULDOPRGLILFDWLRQUHTXLULQJD6HUYLFH 3ODQ$PHQGPHQWLQFOXGHZLWKRXWOLPLWDWLRQ DVRI'HFHPEHURI WKHUHSRUW\HDUDQGWKHVWDWHPHQWRIRSHUDWLRQ LHUHYHQXHDQGH[SHQGLWXUHV IRUWKHUHSRUW\HDU  &DSLWDO([SHQGLWXUHV 8QOHVVGLVFORVHGZLWKLQDVHSDUDWHVFKHGXOHWRWKHILQDQFLDOVWDWHPHQWVD VXPPDU\RIWKHFDSLWDOH[SHQGLWXUHVLQFXUUHGE\WKH'LVWULFWLQGHYHORSPHQWRILPSURYHPHQWVLQ WKHUHSRUW\HDU  )LQDQFLDO2EOLJDWLRQV 8QOHVVGLVFORVHGZLWKLQDVHSDUDWHVFKHGXOHWRWKHILQDQFLDOVWDWHPHQWVD VXPPDU\RIILQDQFLDOREOLJDWLRQVRIWKH'LVWULFWDWWKHHQGRIWKHUHSRUW\HDULQFOXGLQJWKHDPRXQW RIRXWVWDQGLQJ'HEWWKHDPRXQWDQGWHUPVRIDQ\QHZ'LVWULFW'HEWLVVXHGLQWKHUHSRUW\HDUWKH WRWDODVVHVVHGYDOXDWLRQRIDOO7D[DEOH3URSHUW\ZLWKLQWKH6HUYLFH$UHDDVRI-DQXDU\RIWKH UHSRUW\HDUDQGWKHFXUUHQWWRWDO'LVWULFWPLOOOHY\SOHGJHGWR'HEWUHWLUHPHQWLQWKHUHSRUW\HDU  %RDUG&RQWDFW,QIRUPDWLRQ 7KHQDPHVDQGFRQWDFWLQIRUPDWLRQRIWKHFXUUHQWGLUHFWRUVRQWKH'LVWULFW¶V %RDUGDQ\'LVWULFWPDQDJHUDQGWKHDWWRUQH\IRUWKH'LVWULFWVKDOOEHOLVWHGLQWKHUHSRUW7KH 'LVWULFW¶VFXUUHQWRIILFHDGGUHVVSKRQHQXPEHUHPDLODGGUHVVDQGDQ\ZHEVLWHDGGUHVVVKDOODOVR EHOLVWHGLQWKHUHSRUW  2WKHU,QIRUPDWLRQ $Q\ RWKHU LQIRUPDWLRQ GHHPHG UHOHYDQW E\ WKH &LW\ &RXQFLO RU GHHPHG UHDVRQDEO\QHFHVVDU\E\WKH&LW\0DQDJHU D. Reporting of Significant Events. 7KH DQQXDO UHSRUW RI HDFK 'LVWULFW VKDOO LQFOXGH LQIRUPDWLRQ DV WR DQ\ RI WKH IROORZLQJWKDWRFFXUUHGGXULQJWKHUHSRUW\HDU  %RXQGDU\ FKDQJHV PDGH RU SURSRVHG WR WKH 'LVWULFW¶V %RXQGDULHV DV RI 'HFHPEHURIWKHUHSRUW\HDU  ,QWHUJRYHUQPHQWDO $JUHHPHQWV ZLWK RWKHU JRYHUQPHQWDO HQWLWLHV HLWKHU HQWHUHGLQWRRUSURSRVHGDVRI'HFHPEHURIWKHUHSRUW\HDU  &RSLHVRIWKH'LVWULFW¶VUXOHVDQGUHJXODWLRQVLIDQ\RUVXEVWDQWLDOFKDQJHV WRWKH'LVWULFW¶VUXOHVDQGUHJXODWLRQVDVRI'HFHPEHURIWKHUHSRUW\HDU VKDOOQRWEH VHWDVLGHIRUDQ\UHDVRQLQFOXGLQJE\MXGLFLDODFWLRQDEVHQWD6HUYLFH3ODQ$PHQGPHQWDQG LL  DUHWRJHWKHUZLWKDOORWKHUUHTXLUHPHQWVRI6WDWHODZLQFOXGHGLQWKH³SROLWLFDORUJRYHUQPHQWDO SRZHUV´UHVHUYHGWRWKH6WDWHXQGHUWKH86%DQNUXSWF\&RGH 86& 6HFWLRQDQGDUH DOVRLQFOXGHGLQWKH³UHJXODWRU\RUHOHFWRUDODSSURYDOQHFHVVDU\XQGHUDSSOLFDEOHQRQEDQNUXSWF\ ODZ´DVUHTXLUHGIRUFRQILUPDWLRQRID&KDSWHU%DQNUXSWF\3ODQXQGHU%DQNUXSWF\&RGH6HFWLRQ  E   XIII. ANNUAL REPORTS AND BOARD MEETINGS A. General. (DFKRIWKH'LVWULFWVVKDOOEHUHVSRQVLEOHIRUVXEPLWWLQJDQDQQXDOUHSRUWWRWKH&LW\ &OHUNQRODWHUWKDQ6HSWHPEHUVWRIHDFK\HDUIROORZLQJWKH\HDULQZKLFKWKH2UGHUVDQG'HFUHHV FUHDWLQJWKH'LVWULFWVKDYHEHHQLVVXHG7KH'LVWULFWVPD\ILOHDFRQVROLGDWHGDQQXDOUHSRUW7KH DQQXDOUHSRUW V PD\EHPDGHDYDLODEOHWRWKHSXEOLFRQWKH&LW\¶VZHEVLWH B. Board Meetings. (DFKRIWKH'LVWULFWV¶%RDUGVVKDOOKROGDWOHDVWRQHSXEOLFERDUGPHHWLQJLQWKUHH RIWKHIRXUTXDUWHUVRIHDFKFDOHQGDU\HDUEHJLQQLQJLQWKHILUVWIXOOFDOHQGDU\HDUDIWHUD'LVWULFW¶V FUHDWLRQ7KLVPHHWLQJUHTXLUHPHQWVKDOOQRWDSSO\XQWLOWKHUHLVDWOHDVWRQH(QG8VHURISURSHUW\ ZLWKLQWKH'LVWULFW$OVRWKLVUHTXLUHPHQWVKDOOQRORQJHUDSSO\ZKHQDPDMRULW\RIWKHGLUHFWRUV RQ WKH 'LVWULFW¶V %RDUG DUH (QG 8VHUV  1RWLFH IRU HDFK RI WKHVH PHHWLQJV VKDOO EH JLYHQ LQ DFFRUGDQFHZLWKWKHUHTXLUHPHQWVRIWKH6SHFLDO'LVWULFW$FWDQGRWKHUDSSOLFDEOH6WDWH/DZ C. Report Requirements. 8QOHVVZDLYHGLQZULWLQJE\WKH&LW\0DQDJHUHDFKRIWKH'LVWULFWV¶DQQXDOUHSRUW PXVWLQFOXGHWKHIROORZLQJ  1DUUDWLYH $QDUUDWLYHVXPPDU\RIWKHSURJUHVVRIWKH'LVWULFWLQLPSOHPHQWLQJLWV 6HUYLFH3ODQIRUWKHUHSRUW\HDU \HDUVIURP'HFHPEHURIWKHWD[FROOHFWLRQ\HDUDIWHUZKLFKWKH5HJLRQDO0LOO/HY\LVILUVW LPSRVHG G. Completion of Regional Improvements. $OO5HJLRQDO,PSURYHPHQWVVKDOOEHFRPSOHWHGSULRUWRWKHHQGRIWKHWZHQW\ILYH  \HDU5HJLRQDO0LOO/HY\WHUP H. City Authority to Require Imposition. 7KH&LW\¶VDXWKRULW\WRUHTXLUHD'LVWULFWWRLQLWLDWHWKHLPSRVLWLRQRID5HJLRQDO 0LOO/HY\VKDOOH[SLUHILIWHHQ  \HDUVDIWHU'HFHPEHUVWRIWKH\HDULQZKLFKVDLG'LVWULFWILUVW LPSRVHVD'HEW0LOO/HY\ I. Regional Mill Levy Not Included in Other Mill Levies. 7KH5HJLRQDO0LOO/HY\LPSRVHGVKDOOQRWEHDSSOLHGWRZDUGWKHFDOFXODWLRQRIWKH $JJUHJDWH0LOO/HY\0D[LPXP J. Gallagher Adjustment. ,QWKHHYHQWWKHPHWKRGRIFDOFXODWLQJDVVHVVHGYDOXDWLRQLVFKDQJHG-DQXDU\ RUDQ\FRQVWLWXWLRQDOO\PDQGDWHGWD[FUHGLWFXWRUDEDWHPHQWWDNHVHIIHFWDIWHU-DQXDU\ WKH5HJLRQDO0LOO/HY\PD\EHLQFUHDVHGRUVKDOOEHGHFUHDVHGWRUHIOHFWVXFKFKDQJHVVXFK LQFUHDVHVRUGHFUHDVHVVKDOOEHGHWHUPLQHGE\HDFKRIWKH'LVWULFWV¶%RDUGVLQJRRGIDLWKVRWKDWWR WKHH[WHQWSRVVLEOHWKHDFWXDOWD[UHYHQXHVJHQHUDWHGE\WKH5HJLRQDO0LOO/HY\DVDGMXVWHGDUH  2QJRLQJ DGPLQLVWUDWLRQ RSHUDWLRQV DQG PDLQWHQDQFH FRVWV PD\ EH SDLG IURP SURSHUW\ WD[HV FROOHFWHG WKURXJK WKH LPSRVLWLRQ RI DQ 2SHUDWLQJ 0LOO /HY\ VXEMHFW WR WKH OLPLWDWLRQV VHW IRUWK LQ6HFWLRQ,;% DVZHOODVIURPRWKHUUHYHQXHVOHJDOO\ DYDLODEOHWRWKH 'LVWULFWV X. REGIONAL IMPROVEMENTS 7KH'LVWULFWVVKDOOEHDXWKRUL]HGWRSURYLGHIRUWKHSODQQLQJGHVLJQDFTXLVLWLRQIXQGLQJ FRQVWUXFWLRQLQVWDOODWLRQUHORFDWLRQUHGHYHORSPHQWDGPLQLVWUDWLRQDQGRYHUKHDGFRVWVUHODWHGWR WKHSURYLVLRQRI5HJLRQDO,PSURYHPHQWV$WWKHGLVFUHWLRQRIWKH&LW\WKH'LVWULFWVVKDOOLPSRVH D 5HJLRQDO ,PSURYHPHQW 0LOO /HY\ RQ DOO SURSHUW\ ZLWKLQ WKH 'LVWULFWV¶ %RXQGDULHV DQG DQ\ SURSHUWLHVWKHUHDIWHULQFOXGHGLQWKH%RXQGDULHVXQGHUWKHIROORZLQJWHUPV A. Regional Mill Levy Authority. 7KH'LVWULFWVVKDOOVHHNWKHDXWKRULW\WRLPSRVHDQDGGLWLRQDO5HJLRQDO0LOO/HY\ RIILYH  PLOOVDVSDUWRIWKH'LVWULFWV¶LQLWLDO7$%25HOHFWLRQ7KH'LVWULFWVVKDOODOVRVHHNIURP WKH HOHFWRUDWH LQ WKDW HOHFWLRQ WKH DXWKRULW\ XQGHU 7$%25 WR HQWHU LQWR DQ LQWHUJRYHUQPHQWDO DJUHHPHQWZLWKWKH&LW\REOLJDWLQJWKH'LVWULFWVWRSD\ DVDPXOWLSOHILVFDO\HDUREOLJDWLRQWKH SURFHHGV IURP WKH 5HJLRQDO 0LOO /HY\ WR WKH &LW\  2EWDLQLQJ VXFK YRWHUDSSURYDO RI WKLV LQWHUJRYHUQPHQWDO DJUHHPHQW VKDOO EH D SUHFRQGLWLRQ WR WKH 'LVWULFWV LVVXLQJ DQ\ 'HEW DQG LPSRVLQJWKH'HEW0LOO/HY\WKH2SHUDWLQJ0LOO/HY\DQG)HHVIRUWKHUHSD\PHQWRI'HEWXQGHU WKLV6HUYLFH3ODQ B. Regional Mill Levy Imposition. 7KH'LVWULFWVVKDOOHDFKLPSRVHWKH5HJLRQDO0LOO/HY\DWDUDWHQRWWRH[FHHGILYH   PLOOV ZLWKLQ RQH \HDU RI UHFHLYLQJ ZULWWHQ QRWLFH IURP WKH &LW\ 0DQDJHU WR WKH 'LVWULFWV UHTXHVWLQJWKHLPSRVLWLRQRIWKH5HJLRQDO0LOO/HY\DQGVWDWLQJWKHPLOOUDWHWREHLPSRVHG C. City Notice Regarding Regional Improvements. 6XFKQRWLFHIURPWKH&LW\VKDOOSURYLGHDGHVFULSWLRQRIWKH5HJLRQDO,PSURYHPHQWV WREHFRQVWUXFWHGDQGDQDQDO\VLVH[SODLQLQJKRZWKH5HJLRQDO,PSURYHPHQWVZLOOEHEHQHILFLDOWR SURSHUW\RZQHUVZLWKLQWKH6HUYLFH$UHD7KH&LW\VKDOOPDNHDJRRGIDLWKHIIRUWWRUHTXLUHWKDW SODQQHG GHYHORSPHQWV WKDW L  DUH DGMDFHQW WR WKH 6HUYLFH $UHD DQG LL  ZLOO EHQHILW IURP WKH 5HJLRQDO,PSURYHPHQWDOVRLPSRVHD5HJLRQDO0LOO/HY\WRWKHH[WHQWSRVVLEOH D. Regional Improvements Authorized Under Service Plan. ,IVRQRWLILHGE\WKH&LW\0DQDJHUWKH5HJLRQDO,PSURYHPHQWVVKDOOEHFRQVLGHUHG SXEOLFLPSURYHPHQWVWKDWWKH'LVWULFWVZRXOGRWKHUZLVHEHDXWKRUL]HGWRGHVLJQFRQVWUXFWLQVWDOO UHGHVLJQUHFRQVWUXFWUHSDLURUUHSODFHSXUVXDQWWRWKLV6HUYLFH3ODQDQGDSSOLFDEOHODZ ZKLFKZLOOEHHOLJLEOH IRUUHLPEXUVHPHQWIURP'HEWSURFHHGV 7KHPD[LPXPXQGHUZULWLQJGLVFRXQWVKDOOEHWKUHH SHUFHQW  'HEWZKHQLVVXHGZLOOFRPSO\ZLWKDOOUHOHYDQWUHTXLUHPHQWVRIWKLV6HUYLFH3ODQ WKH 6SHFLDO 'LVWULFW $FW RWKHU DSSOLFDEOH 6WDWH ODZ DQG IHGHUDO ODZ DV WKHQ DSSOLFDEOH WR WKH LVVXDQFHRISXEOLFVHFXULWLHV D. Interest Rate and Underwriting Discount Certification. 7KH'LVWULFWVVKDOOUHWDLQDQ([WHUQDO)LQDQFLDO$GYLVRUWRSURYLGHDZULWWHQRSLQLRQ RQWKHPDUNHWUHDVRQDEOHQHVVRIWKHLQWHUHVWUDWHRQDQ\'HEWDQGDQ\XQGHUZULWHUGLVFRXQWSD\HG E\WKH'LVWULFWVDVSDUWRID'HEWILQDQFLQJWUDQVDFWLRQ7KH'LVWULFWVVKDOOSURYLGHWKLVZULWWHQ RSLQLRQWRWKH&LW\EHIRUHLVVXLQJDQ\'HEWEDVHGRQLW E. Disclosure to Purchasers. ,QRUGHUWRQRWLI\IXWXUH(QG8VHUVZKRDUHSXUFKDVLQJUHVLGHQWLDOORWVRUGZHOOLQJV XQLWVLQWKH6HUYLFH$UHDWKDWWKH\ZLOOEHSD\LQJLQDGGLWLRQWRWKHSURSHUW\WD[HVRZHGWRRWKHU WD[LQJJRYHUQPHQWDOHQWLWLHVWKHSURSHUW\WD[HVLPSRVHGXQGHUWKH'HEW0LOO/HY\WKH2SHUDWLQJ 0LOO/HY\DQGSRVVLEO\WKH5HJLRQDO0LOO/HY\WKH'LVWULFWVVKDOOQRWEHDXWKRUL]HGWRLVVXHDQ\ 'HEWXQGHUWKLV6HUYLFH3ODQXQWLOWKHUHLVLQFOXGHGLQWKH'HYHORSHU¶V$SSURYHG'HYHORSPHQW 3ODQSURYLVLRQVWKDWUHTXLUHWKHIROORZLQJ  7KDWWKH'HYHORSHUDQGLWVVXFFHVVRUVDQGDVVLJQVVKDOOSUHSDUHDQGVXEPLW WRWKH&LW\0DQDJHUIRUKLVDSSURYDODGLVFORVXUHQRWLFHLQVXEVWDQWLDOO\WKHIRUPDWWDFKHGKHUHWR DVExhibit H WKH³Disclosure Notice´   7KDW ZKHQ WKH 'LVFORVXUH 1RWLFH LV DSSURYHG E\ WKH &LW\0DQDJHUWKH 'HYHORSHUVKDOOUHFRUGWKH'LVFORVXUH1RWLFHLQWKH/DULPHU&RXQW\&OHUNDQG5HFRUGHUV2IILFH DQG  7KDWWKHDSSURYHG'LVFORVXUH1RWLFHVKDOOEHSURYLGHGE\WKH'HYHORSHU DQGE\ LWVVXFFHVVRUVDQGDVVLJQVWRHDFKSRWHQWLDO(QG8VHUSXUFKDVHURIDUHVLGHQWLDOORWRU GZHOOLQJXQLWLQWKH6HUYLFH$UHDEHIRUHWKDWSXUFKDVHUHQWHUVLQWRDZULWWHQDJUHHPHQWIRUWKH SXUFKDVHDQGVDOHRIWKDWUHVLGHQWLDOORWRUGZHOOLQJXQLW F. External Financial Advisor. $Q([WHUQDO)LQDQFLDO$GYLVRUVKDOOEHUHWDLQHGE\WKH'LVWULFWVWRSURYLGHDZULWWHQ RSLQLRQDVWRZKHWKHUDQ\'HEWLVVXDQFHLVLQWKHEHVWLQWHUHVWRIWKHLVVXLQJ'LVWULFWRQFHWKHWRWDO DPRXQWRI'HEWLVVXHGE\VXFK'LVWULFWH[FHHGV)LYH0LOOLRQ'ROODUV  7KH([WHUQDO )LQDQFLDO$GYLVRULVWRSURYLGHDGYLFHWRWKHLVVXLQJ'LVWULFW¶V%RDUGUHJDUGLQJWKHSURSRVHGWHUPV DQG ZKHWKHU 'HEW FRQGLWLRQVDUH UHDVRQDEOH EDVHG XSRQ WKH VWDWXV RI GHYHORSPHQW ZLWKLQ WKH 'LVWULFWWKHSURMHFWHGWD[EDVHLQFUHDVHLQWKH'LVWULFWWKHVHFXULW\RIIHUHGDQGRWKHUFRQVLGHUDWLRQV DVPD\EHLGHQWLILHGE\WKH$GYLVRU7KHLVVXLQJ'LVWULFWVKDOOLQFOXGHLQWKHWUDQVFULSWRIDQ\ %RQG WUDQVDFWLRQRURWKHUDSSURSULDWHILQDQFLQJGRFXPHQWDWLRQIRUUHODWHG'HEWLQVWUXPHQWD  PLOOVXQWLOWKH'LVWULFWLPSRVHVD'HEW0LOO/HY\2QFHD'LVWULFWLPSRVHVD'HEW0LOO/HY\RI DQ\DPRXQWWKDW'LVWULFW¶V2SHUDWLQJ0LOO/HY\VKDOOQRWH[FHHGWHQ  PLOOVDWDQ\SRLQW  *DOODJKHU$GMXVWPHQWV ,Q WKH HYHQW WKH6WDWH¶VPHWKRGRIFDOFXODWLQJDVVHVVHGYDOXDWLRQIRUWKH 7D[DEOH3URSHUW\FKDQJHVDIWHU-DQXDU\RUDQ\FRQVWLWXWLRQDOO\PDQGDWHGWD[FUHGLWFXW RUDEDWHPHQWWDNHVHIIHFWDIWHU-DQXDU\WKH'LVWULFWV¶$JJUHJDWH0LOO/HY\'HEW0LOO /HY\2SHUDWLQJ0LOO/HY\DQG$JJUHJDWH0LOO/HY\0D[LPXPDPRXQWVKHUHLQSURYLGHGPD\ EHLQFUHDVHGRUGHFUHDVHGWRUHIOHFWVXFKFKDQJHVVXFKLQFUHDVHVRUGHFUHDVHVVKDOOEHGHWHUPLQHG E\ WKH 'LVWULFWV¶ %RDUGV LQ JRRG IDLWK VR WKDW WR WKH H[WHQW SRVVLEOH WKH DFWXDO WD[ UHYHQXHV JHQHUDWHGE\VXFKPLOOOHYLHVDVDGMXVWHGDUHQHLWKHUHQKDQFHGQRUGLPLQLVKHGDVDUHVXOWRIVXFK FKDQJHRFFXUULQJDIWHU-DQXDU\)RUSXUSRVHVRIWKHIRUHJRLQJDFKDQJHLQWKHUDWLRRI DFWXDO YDOXDWLRQ WR DVVHVVHG YDOXDWLRQ ZLOO EH D FKDQJH LQ WKH PHWKRG RI FDOFXODWLQJ DVVHVVHG YDOXDWLRQ  ([FHVVLYH0LOO/HY\3OHGJHV $Q\'HEWLVVXHGZLWKDPLOOOHY\SOHGJHRUZKLFKUHVXOWVLQDPLOOOHY\ SOHGJH WKDW H[FHHGV WKH $JJUHJDWH 0LOO /HY\ 0D[LPXP RU WKH 0D[LPXP 'HEW 0LOO /HY\ ,PSRVLWLRQ7HUPVKDOOEHGHHPHGDPDWHULDOPRGLILFDWLRQRIWKLV6HUYLFH3ODQDQGVKDOOQRWEHDQ DXWKRUL]HGLVVXDQFHRI'HEWXQOHVVDQGXQWLOVXFKPDWHULDOPRGLILFDWLRQKDVEHHQDSSURYHGE\D 6HUYLFH3ODQ$PHQGPHQW  5HIXQGLQJ'HEW 7KH0D[LPXP'HEW0LOO/HY\,PSRVLWLRQ7HUPPD\EHH[FHHGHGIRU'HEW UHIXQGLQJSXUSRVHVLI  DPDMRULW\RIWKHLVVXLQJ'LVWULFW¶V%RDUGLVFRPSRVHGRI(QG8VHUVDQG KDYHYRWHGLQIDYRURIDUHIXQGLQJRIDSDUWRUDOORIWKH'HEWRU  VXFKUHIXQGLQJZLOOUHVXOWLQ DQHWSUHVHQWYDOXHVDYLQJV  0D[LPXP'HEW$XWKRUL]DWLRQ 7KH'LVWULFWVDQWLFLSDWHDSSUR[LPDWHO\LQSURMHFWFRVWVLQ GROODUVDVVHWIRUWKLQExhibit FDQGDQWLFLSDWHLVVXLQJDSSUR[LPDWHO\LQ'HEWWRSD\ VXFK FRVWV DV VHW IRUWK LQExhibit HZKLFK'HEWLVVXDQFHDPRXQWVKDOOEHWKHDPRXQWRIWKH 0D[LPXP'HEW$XWKRUL]DWLRQ,QDGGLWLRQD'LVWULFWVKDOOQRWLVVXHDQ\'HEWXQOHVVDQGXQWLO GHOLYHU\RIWKH'LVWULFW¶V3XEOLF%HQHILWVKDYHEHHQVHFXUHGDVUHTXLUHGLQ6HFWLRQ,9%RIWKLV 6HUYLFH3ODQ7KH'LVWULFWVFROOHFWLYHO\ VKDOOQRWLVVXH'HEWLQH[FHVVRIWKH0D[LPXP'HEW $XWKRUL]DWLRQ  %RQGV ZKLFK KDYH EHHQ UHIXQGHG VKDOO QRW FRXQW DJDLQVW WKH0D[LPXP 'HEW $XWKRUL]DWLRQ7KH'LVWULFWVPXVWREWDLQIURPWKH&LW\&RXQFLOD6HUYLFH3ODQ$PHQGPHQWSULRU WRLVVXLQJ'HEWLQH[FHVVRIWKH0D[LPXP'HEW$XWKRUL]DWLRQ  PLOOV  5HJLRQDO0LOO/HY\1RW,QFOXGHGLQ2WKHU0LOO/HYLHV 7KH5HJLRQDO0LOO/HY\VKDOOQRWEHFRXQWHGDJDLQVWWKH$JJUHJDWH0LOO /HY\0D[LPXP  WKHGHVLJQSKDVLQJRIFRQVWUXFWLRQORFDWLRQDQGFRPSOHWLRQRI3XEOLF,PSURYHPHQWVZLOO EH GHWHUPLQHG E\ WKH 'LVWULFWV WR FRLQFLGH ZLWK WKH SKDVLQJ DQG GHYHORSPHQW RI WKH 3ODQQHG 'HYHORSPHQWDQGWKHDYDLODELOLW\RIIXQGLQJVRXUFHV LL WKH'LVWULFWVPD\LQWKHLUGLVFUHWLRQ SKDVHWKHFRQVWUXFWLRQFRPSOHWLRQRSHUDWLRQDQGPDLQWHQDQFHRI3XEOLF,PSURYHPHQWVRUGHIHU GHOD\UHVFKHGXOHUHSKDVHUHORFDWHRUGHWHUPLQHQRWWRSURFHHGZLWKWKHFRQVWUXFWLRQFRPSOHWLRQ RSHUDWLRQDQGPDLQWHQDQFHRI3XEOLF,PSURYHPHQWVDQGVXFKDFWLRQVRUGHWHUPLQDWLRQVVKDOOQRW FRQVWLWXWHD6HUYLFH3ODQ$PHQGPHQW LLL WKH'LVWULFWVVKDOODOVREHSHUPLWWHGWRDOORFDWHFRVWV EHWZHHQVXFKFDWHJRULHVRIWKH3XEOLF,PSURYHPHQWVDVGHHPHGQHFHVVDU\LQWKHLUGLVFUHWLRQDQG LY  WR WKH H[WHQW WKDW WKH &LW\ UHLPEXUVHV D GHYHORSHU IRU 3XEOLF ,PSURYHPHQWV WKDW ZRXOG RWKHUZLVH EH UHLPEXUVDEOH XQGHU WKH 6SHFLDO 'LVWULFW$FW WKH 'LVWULFW VKDOO QRW UHLPEXUVH WKH GHYHORSHUIRUVXFK3XEOLF,PSURYHPHQWV 7KH3XEOLF,PSURYHPHQWVVKDOOEHOLVWHGXVLQJDQRZQHUVKLSDQGPDLQWHQDQFHPDWUL[LQ Exhibit F HLWKHU LQGLYLGXDOO\ RU FDWHJRULFDOO\ WR LGHQWLI\ WKH RZQHUVKLS DQG PDLQWHQDQFH UHVSRQVLELOLWLHVRIWKH3XEOLF,PSURYHPHQWV WKHQHWHIIHFWLYHLQWHUHVWUDWH FDOFXODWHG DV GHILQHG LQ &56 6HFWLRQ    WREHERUQHE\>LQVHUWWKHGHVLJQDWLRQRIWKH 'HEW@ GRHV QRW H[FHHG D UHDVRQDEOH FXUUHQW >WD[ H[HPSW@>WD[DEOH@LQWHUHVWUDWHXVLQJFULWHULDGHHPHG DSSURSULDWH E\ XV >PH@ DQG EDVHG XSRQ RXU >P\@ DQDO\VLVRIFRPSDUDEOHKLJK\LHOGVHFXULWLHVDQG   WKH VWUXFWXUH RI >LQVHUW GHVLJQDWLRQ RI WKH 'HEW@ LQFOXGLQJ PDWXULWLHV DQG HDUO\ UHGHPSWLRQ DVDPHQGHGIXUQLVK VHFXULW\VHUYLFHVSXUVXDQWWRDQLQWHUJRYHUQPHQWDODJUHHPHQWZLWKWKH&LW\  *UDQWVIURP*RYHUQPHQWDO$JHQFLHV5HVWULFWLRQ 7KH'LVWULFWVVKDOOQRWDSSO\IRUJUDQWIXQGVGLVWULEXWHGE\DQ\DJHQF\RI WKH8QLWHG6WDWHV*RYHUQPHQWRUWKH6WDWHZLWKRXWWKHSULRUZULWWHQDSSURYDORIWKH&LW\0DQDJHU 7KLVGRHVQRWUHVWULFWWKHFROOHFWLRQRI)HHVIRUVHUYLFHVSURYLGHGE\WKH'LVWULFWVWRWKH8QLWHG 6WDWHV*RYHUQPHQWRUWKH6WDWH  *ROI&RXUVH&RQVWUXFWLRQ5HVWULFWLRQ $FNQRZOHGJLQJWKDWWKH&LW\KDVILQDQFHGSXEOLFJROIFRXUVHVDQGGHVLUHV WRFRRUGLQDWHWKHFRQVWUXFWLRQRISXEOLFJROIFRXUVHVZLWKLQWKH&LW\¶VERXQGDULHVWKH'LVWULFWV VKDOOQRWEHDXWKRUL]HGWRSODQGHVLJQDFTXLUHFRQVWUXFWLQVWDOOUHORFDWHUHGHYHORSILQDQFHRZQ DJUHHLQJWRSURYLGHWKRVH3XEOLF%HQHILWVDVDOHJDOO\HQIRUFHDEOHPXOWLSOHILVFDO\HDUREOLJDWLRQ RIWKH'LVWULFWXQGHU7$%25RUE\ LL VHFXULQJSHUIRUPDQFHRIWKDWREOLJDWLRQZLWKDVXUHW\ERQG OHWWHURIFUHGLWRURWKHUVHFXULW\DFFHSWDEOHWRWKH&LW\DQGDQ\VXFKLQWHUJRYHUQPHQWDODJUHHPHQW PXVWEHDSSURYHGE\WKH&LW\&RXQFLOE\UHVROXWLRQ  )RU DQ\ SRUWLRQ RI WKH 3XEOLF %HQHILWV WR EH SURYLGHG E\ RQH RUPRUH 'HYHORSHUV RI WKH 3ODQQHG 'HYHORSPHQW HDFK VXFK 'HYHORSHU PXVWHLWKHU L HQWHULQWRD GHYHORSPHQWDJUHHPHQWZLWKWKH&LW\XQGHUWKH'HYHORSHU¶VDSSOLFDEOH$SSURYHG'HYHORSPHQW 3ODQZKLFKDJUHHPHQWPXVWOHJDOO\REOLJDWHWKH'HYHORSHUWRSURYLGHWKRVH3XEOLF%HQHILWVEHIRUH WKH&LW\LVUHTXLUHGWRLVVXHEXLOGLQJSHUPLWVDQGRUFHUWLILFDWHVRIRFFXSDQF\IRUVWUXFWXUHVWREH EXLOWXQGHUWKH$SSURYHG'HYHORSPHQW3ODQIRUWKDWSKDVHRIWKH3ODQQHG'HYHORSPHQWRU LL  VHFXUHVXFKREOLJDWLRQVZLWKDVXUHW\ERQGOHWWHURIFUHGLWRURWKHUVHFXULW\DFFHSWDEOHWRWKH&LW\ DQGDOOVXFKGHYHORSPHQWDJUHHPHQWVPXVWEHDSSURYHGE\WKH&LW\&RXQFLOE\UHVROXWLRQRU  )RUDQ\SRUWLRQRIWKH3XEOLF%HQHILWVWREHSURYLGHGLQSDUWE\RQHRUPRUH RI WKH 'LVWULFWV LQ WKH 3URMHFW DQG LQ SDUW E\ RQH RU PRUH RI WKH 'HYHORSHUV LQ WKH 3ODQQHG 'HYHORSPHQW RU 3URMHFW DQ DJUHHPHQW EHWZHHQ WKH &LW\ WKH DIIHFWHG 'LVWULFW V  DQG WKH 'HYHORSHU V WKDWVHFXUHVVXFK3XEOLF%HQHILWVDVOHJDOO\ELQGLQJREOLJDWLRQVXVLQJWKHPHWKRGV GHVFULEHGLQVXEVHFWLRQVDQGDERYHDQGDOOVXFKDJUHHPHQWVPXVWEHDSSURYHGE\WKH&LW\ &RXQFLOE\UHVROXWLRQ C. Assessed Valuation. 7KHFXUUHQWDVVHVVHGYDOXDWLRQRIWKH6HUYLFH$UHDLVDSSUR[LPDWHO\DQGDW EXLOGRXWLVH[SHFWHGWREH7KHVHDPRXQWVDUHH[SHFWHGWREHVXIILFLHQWWRUHDVRQDEO\ GLVFKDUJHWKH'HEWDVGHPRQVWUDWHGLQWKH)LQDQFLDO3ODQ V. INCLUSION OF LAND IN THE SERVICE AREA 7KH'LVWULFWVVKDOOQRWDGGDQ\UHDOSURSHUW\WRWKH6HUYLFH$UHDZLWKRXWWKH&LW\¶VDSSURYDO DQG LQFRPSOLDQFHZLWKWKH6SHFLDO'LVWULFW$FW 2QFHD'LVWULFWKDVLVVXHG'HEWLWVKDOOQRW H[FOXGHUHDOSURSHUW\IURPWKH'LVWULFW¶VERXQGDULHVZLWKRXWWKHSULRUZULWWHQFRQVHQWRIWKH&LW\ &RXQFLO KRXVLQJXQLWVZLOOEHGHVLJQDWHGDVDIIRUGDEOH KRXVLQJHLWKHUIRUVDOHRUIRUUHQWDQGWKHPDMRULW\RIWKHUHVWRIWKHXQLWVZLOOEHVROGDVDWWDLQDEOH KRXVLQJXQLWV7KH3ODQQHG'HYHORSPHQWLVDOVRDQWLFLSDWHGWRLQFOXGHDPL[HGXVHFHQWHUWKDW ZLOORIIHUOLJKWFRPPHUFLDOXVHRQWKHILUVWIORRUUHVLGHQWLDOIRUUHQWXQLWVRQWKHVHFRQGIORRUDQG VPDOODPHQLWLHVRSHQWRWKHSXEOLF7KHHVWLPDWHGUHVLGHQWSRSXODWLRQDWEXLOGRXWLV &RQVWUXFWLRQRIWKH3ODQQHG'HYHORSPHQWLVSODQQHGWREHFRPSOHWHGE\\HDU ,QDFFRUGDQFHZLWKWKH)LQDQFLDO3ODQWKHHVWLPDWHGDVVHVVHGYDOXDWLRQ RI WKH 3ODQQHG 'HYHORSPHQWLQLVHVWLPDWHGWREHIRUUHVLGHQWLDODQGIRUFRPPHUFLDO DQGLQLWLVHVWLPDWHGWREHIRUUHVLGHQWLDODQGIRUFRPPHUFLDO $SSURYDORIWKLV6HUYLFH3ODQE\WKH&LW\&RXQFLOGRHVQRWFRQVWLWXWHQRULPSO\ DSSURYDORIWKHGHYHORSPHQWRIDQ\SDUWLFXODUODQGXVHIRUDQ\VSHFLILFDUHDZLWKLQWKH'LVWULFWV $Q\VXFKDSSURYDOPXVWEHFRQWDLQHGZLWKLQDQ$SSURYHG'HYHORSPHQW3ODQ B. Public Benefits. ,QDGGLWLRQWRSURYLGLQJWKH3XEOLF,PSURYHPHQWVGHVFULEHGLQExhibit FDQGWKH 5HJLRQDO ,PSURYHPHQWVWKH'LVWULFWVZLOOGHOLYHUVHYHUDOSXEOLFEHQHILWVWRWKHFRPPXQLW\ LQ DFFRUGDQFHZLWKWKH&LW\¶V0HWUR'LVWULFW6HUYLFH3ODQ3ROLF\7KHSXEOLFEHQHILWVLQFOXGHEXW DUHQRWOLPLWHGWRGHYHORSLQJFULWLFDORQVLWHDQGRIIVLWHSXEOLFLQIUDVWUXFWXUHHPSOR\LQJKLJK TXDOLW\DQGVPDUWJURZWKSUDFWLFHVFUHDWLQJDIIRUGDEOHKRXVLQJXQLWVFUHDWLQJDWWDLQDEOHKRXVLQJ XQLWVWRVXSSRUWWKHZRUNIRUFHDQGLQFRUSRUDWLQJHQYLURQPHQWDOVXVWDLQDELOLW\WKURXJKHQHUJ\DQG ZDWHU FRQVHUYDWLRQ DQG HQKDQFHG PXOWLPRGDO WUDQVSRUWDWLRQ DOO RI ZKLFK DUH VSHFLILFDOO\ GHVFULEHGLQExhibit IDWWDFKHGKHUHWRDQGLQFRUSRUDWHGKHUHLQE\WKLVUHIHUHQFH FROOHFWLYHO\WKH ³Public Benefits´  LVTXDOLILHGWRDGYLVH&RORUDGR JRYHUQPHQWDOHQWLWLHVRQPDWWHUVUHODWLQJWRWKHLVVXDQFHRIVHFXULWLHVE\&RORUDGRJRYHUQPHQWDO HQWLWLHV LQFOXGLQJ PDWWHUV VXFK DV WKH SULFLQJ VDOHV DQG PDUNHWLQJ RI VXFK VHFXULWLHV DQG WKH SURFXULQJRIERQGUDWLQJVFUHGLWHQKDQFHPHQWDQGLQVXUDQFHLQUHVSHFWRIVXFKVHFXULWLHV  VKDOO EHDQXQGHUZULWHULQYHVWPHQWEDQNHURULQGLYLGXDOOLVWHGDVDSXEOLFILQDQFHDGYLVRULQWKH%RQG %X\HU¶V0XQLFLSDO0DUNHW3ODFHRULQWKH&LW\¶VVROHGLVFUHWLRQRWKHUUHFRJQL]HGSXEOLFDWLRQDV DSURYLGHURIILQDQFLDOSURMHFWLRQVDQG  LVQRWDQRIILFHURUHPSOR\HHRIWKH'LVWULFWVRUDQ XQGHUZULWHURIWKH'LVWULFWV¶'HEW FeesPHDQVWKHIHHVUDWHVWROOVSHQDOWLHVDQGFKDUJHVWKH'LVWULFWVDUHDXWKRUL]HG WR LPSRVHDQGFROOHFWXQGHUWKLV6HUYLFH3ODQ Financial PlanPHDQVWKH)LQDQFLDO3ODQGHVFULEHGLQ6HFWLRQ,;RIWKLV6HUYLFH3ODQ ZKLFK ZDV SUHSDUHG E\ '$ 'DYLGVRQ  &R DQ ([WHUQDO $GYLVRU LQ DFFRUGDQFH ZLWK WKH UHTXLUHPHQWV RI WKLV 6HUYLFH 3ODQ DQG GHVFULEHV D  KRZ WKH 3XEOLF ,PSURYHPHQWV DUH WR EH ILQDQFHG E KRZWKH'HEWLVH[SHFWHGWREHLQFXUUHGDQG F WKHHVWLPDWHGRSHUDWLQJUHYHQXH GHULYHGIURPSURSHUW\WD[HVDQGDQ\)HHVIRUWKHILUVWEXGJHW\HDUWKURXJKWKH\HDULQZKLFKDOO 'LVWULFW'HEWLVH[SHFWHGWREHGHIHDVHGRUSDLGLQWKHRUGLQDU\FRXUVH Maximum Debt AuthorizationPHDQVWKHWRWDO'HEWWKH'LVWULFWVDUHSHUPLWWHGWRLVVXH DVVHWIRUWKLQ6HFWLRQ,;%RIWKLV6HUYLFH3ODQ Maximum Debt Mill Levy Imposition TermPHDQVWKHPD[LPXPWHUPGXULQJZKLFKD 'LVWULFW¶V 'HEW 0LOO /HY\ PD\ EH LPSRVHG RQ SURSHUW\ GHYHORSHG LQWKH6HUYLFH$UHDIRU UHVLGHQWLDO XVH ZKLFK VKDOO LQFOXGH UHVLGHQWLDO SURSHUWLHV LQ PL[HGXVH GHYHORSPHQWV  7KLV PD[LPXPWHUPVKDOOQRWH[FHHGIRUW\  \HDUVIURP'HFHPEHURIWKH\HDUWKLV6HUYLFH3ODQ LVDSSURYHGE\&LW\&RXQFLO Operating Mill LevyPHDQVDSURSHUW\WD[PLOOOHY\LPSRVHGRQ7D[DEOH3URSHUW\IRUWKH SXUSRVHRIIXQGLQJD'LVWULFW¶VDGPLQLVWUDWLRQRSHUDWLRQVDQGPDLQWHQDQFHDVDXWKRUL]HGLQWKLV 6HUYLFH3ODQLQFOXGLQJZLWKRXWOLPLWDWLRQUHSDLUDQGUHSODFHPHQWRI3XEOLF,PSURYHPHQWVDQG LPSRVHGDWDUDWHQRWWRH[FHHGWKHOLPLWDWLRQVVHWLQ6HFWLRQ,;%RIWKLV6HUYLFH3ODQ Planned DevelopmentPHDQVWKHSULYDWHGHYHORSPHQWRUUHGHYHORSPHQWRIWKHSURSHUWLHV LQWKH6HUYLFH$UHDFRPPRQO\UHIHUUHGWRDV1RUWKILHOGXQGHUDQ$SSURYHG'HYHORSPHQW3ODQ Project PHDQV WKH LQVWDOODWLRQ DQG FRQVWUXFWLRQ RI WKH 3XEOLF ,PSURYHPHQWV IRU WKH 3ODQQHG'HYHORSPHQW 5HVXOWV .H\7%/65HVXOWV ‡ 7KHSURSRVHGDIIRUGDEOHKRXVLQJ XQLWV ZRXOG KDYHSRVLWLYHLPSDFWVIRUERWKHFRQRPLFDQGVRFLDO VXVWDLQDELOLW\ ‡ RIWKHKRPHVZLOOEHSULFHGDWDWWDLQDEOHSULFH OHYHOVWDUJHWLQJIDPLOLHVPDNLQJRI$0,³WKH PLVVLQJPLGGOH´ ‡ ,QFOXVLRQRIVRODUSDQHOVRQRIKRPHV6RODUZLOO KHOSSRZHUWKHFRPPXQLW\FHQWHU 0LWLJDWLRQ6WUDWHJLHV ‡ &RXOGEHQHILWIURPFRPPLWWLQJWRPRUHVSHFLILF HQYLURQPHQWDOSXEOLFEHQHILWV HJ'2(1HW=HUR5HDG\ KRPHV/(('VWDQGDUGV DQGZDWHUFRQVHUYDWLRQ HIIRUWV XQLWVLQ FRQGRPLQLXPEXLOGLQJVDQG WKHFRPPXQLW\FOXEKRXVH VXIILFLHQWHQRXJKWRSURYLGH XSWRNLORZDWWVRISRZHU SHUEXLOGLQJ $IIRUGDEOH +RXVLQJ RIKRPHVZLOOEH $0,RUOHVV XQLWV ZLWK \HDUGHHGUHVWULFWLRQ 9RXWOHWLQHYHU\JDUDJH $OOWKHKRPHVDWWKH DWWDLQDEOHSULFHSRLQWZLOO FRPPLWWR+(56UDWLQJV UDQJLQJIURPWR :RUNIRUFH +RXVLQJ 7KHUHPDLQLQJ   RIWKHWRWDOQXPEHURI GZHOOLQJXQLWVZLOOEHSULFHG IRUVDOHIRUVRPHRQHPDNLQJ WRRI$0,IRU DWWDLQDEOHKRXVLQJRSWLRQ :DWHU(QHUJ\ &RQVHUYDWLRQ 9LQH 7LPEHUOLQH FRQWULEXWLRQV :DONDELOLW\ 3HGHVWULDQ ,QIUDVWUXFWXUH $3XEOLF$PHQLW\$UHD ZRXOGEHQH[WWRWKHPL[HG XVHEXLOGLQJDQGRIIHU DPHQLWLHVVXFKDVDGRJ ZDVKVWDWLRQELNHUHSDLURU SXPSVWDWLRQRURWKHU VLPLODUSXEOLFXVHIHDWXUHV 0XOWLPRGDO 7UDQVSRUWDWLRQ $YDLODELOLW\RI 7UDQVLW ,QWHUSUHWLYH+LVWRULFDO3DUN DQG*DWHZD\)HDWXUHV ERUGHULQJ$OWD9LVWD (QKDQFH 5HVLOLHQF\ 3XEOLF6SDFH 1HLJKERUKRRGSDUNV &OXEKRXVH6ZLPPLQJSRRO ,QFUHDVH 5HQHZDEOH &DSDFLW\ 6HH*+*UHGXFWLRQ 0L[HG8VH &OXEKRXVHZLOORIIHUOLJKW FRPPHUFLDOXVHRQWKHILUVW IORRU 2II6LWH ,QILOO 5HGHYHORSPHQW 1RUWKILHOGSODQVWRUHSODFH DQGXSVL]HWKHVHZHUOLQH IURP9LQH'ULYHDURXQG$OWD 9LVWDDQGDORQJDSRUWLRQRI /HPD\$YHQXH (FRQRPLF+HDOWK 1RUWKILHOGLVORFDWHGZLWKLQ ZDONLQJDQGRUELNLQJ GLVWDQFHWRVRPHRIWKH ODUJHVWHPSOR\PHQWKXEV (QYLURQPHQWDO6XVWDLQDELOLW\ &ULWLFDO3XEOLF,QIUDVWUXFWXUH 6PDUW*URZWK0DQDJHPHQW 6WUDWHJLF3ULRULWLHV *+*5HGXFWLRQ 2Q6LWH 7KH0HWUR'LVWULFWZLOO ILQDQFHDQGGHOLYHUWKHRQ VLWH5HJLRQDO7UDLODVZHOODV WKHRIIVLWHSHGHVWULDQ FRQQHFWLRQIRUWKH QRUWKHDVWHUQSRUWLRQXSWR WKHLQWHUVHFWLRQDW/HPD\ $YHQXHDQG&RQLIHU6WUHHW ,QFUHDVH 'HQVLW\ $OOH\ORDGKRPHV  ‡ ,QFUHDVHGHQHUJ\HIILFLHQWEXLOGLQJ PDWHULDOVDQGPHWKRGVZHUHFRQVLGHUHGWR LQFUHDVHWKHHQHUJ\HIILFLHQF\RIWKH KRPHV ‡ /DQGPDUNZLOOFRQWUDFWZLWKDJUHHQHQHUJ\ FRQVXOWDQWWRHQVXUHWKHEXLOGLQJVDUH FRQVWUXFWHGDFFRUGLQJWRHQHUJ\HIILFLHQW VWDQGDUGVDQGWKDWRIILFLDO+(56VFRUHV DUHFHUWLILHGXSRQFRPSOHWLRQ  Average Fort Collins HERS Rating – 58 to 62 Average Proposed HERS Rating for Attainable Housing – 49-55 2038 2039 2040 2041 2042 Implied Catpure Rate Source: DA Davidson; Economic & Planning Systems XQLWVLQ FRQGRPLQLXPEXLOGLQJVDQG WKHFRPPXQLW\FOXEKRXVH VXIILFLHQWHQRXJKWRSURYLGH XSWRNLORZDWWVRISRZHU SHUEXLOGLQJ $IIRUGDEOH +RXVLQJ RIKRPHVZLOOEH $0,RUOHVV XQLWV ZLWK \HDUGHHGUHVWULFWLRQ 9RXWOHWLQHYHU\JDUDJH $OOWKHKRPHVDWWKH DWWDLQDEOHSULFHSRLQWZLOO FRPPLWWR+(56UDWLQJV UDQJLQJIURPWR :RUNIRUFH +RXVLQJ 7KHUHPDLQLQJ  RI WKHWRWDOQXPEHURIGZHOOLQJ XQLWVZLOOEHSULFHGIRUVDOHIRU VRPHRQHPDNLQJWR RI$0,IRUDWWDLQDEOH KRXVLQJRSWLRQ :DWHU(QHUJ\ &RQVHUYDWLRQ 9LQH 7LPEHUOLQH FRQWULEXWLRQV :DONDELOLW\ 3HGHVWULDQ ,QIUDVWUXFWXUH $3XEOLF$PHQLW\$UHDZRXOG EHQH[WWRWKHPL[HGXVH EXLOGLQJDQGRIIHUDPHQLWLHV VXFKDVDGRJZDVKVWDWLRQ ELNHUHSDLURUSXPSVWDWLRQRU RWKHUVLPLODUSXEOLFXVH IHDWXUHV 0XOWLPRGDO 7UDQVSRUWDWLRQ $YDLODELOLW\RI 7UDQVLW ,QWHUSUHWLYH+LVWRULFDO3DUN DQG*DWHZD\)HDWXUHV ERUGHULQJ$OWD9LVWD (QKDQFH 5HVLOLHQF\ 3XEOLF6SDFH 1HLJKERUKRRGSDUNV &OXEKRXVH6ZLPPLQJSRRO ,QFUHDVH 5HQHZDEOH &DSDFLW\ 6HH*+*UHGXFWLRQ 0L[HG8VH &OXEKRXVHZLOORIIHUOLJKW FRPPHUFLDOXVHRQWKHILUVW IORRU *+*5HGXFWLRQ 2Q6LWH 7KH0HWUR'LVWULFWZLOOILQDQFH DQGGHOLYHUWKHRQVLWH 5HJLRQDO7UDLODVZHOODVWKH RIIVLWHSHGHVWULDQFRQQHFWLRQ IRUWKHQRUWKHDVWHUQSRUWLRQ XSWRWKHLQWHUVHFWLRQDW /HPD\$YHQXHDQG&RQLIHU 6WUHHW ,QFUHDVH 'HQVLW\ $OOH\ORDGKRPHV 38%/,&%(1(),732/,&<$66(660(170$75,; (QYLURQPHQWDO6XVWDLQDELOLW\ &ULWLFDO3XEOLF,QIUDVWUXFWXUH 6PDUW*URZWK0DQDJHPHQW 6WUDWHJLF3ULRULWLHV 2II6LWH ,QILOO 5HGHYHORSPHQW 1RUWKILHOGSODQVWRUHSODFH DQGXSVL]HWKHVHZHUOLQH IURP9LQH'ULYHDURXQG$OWD 9LVWDDQGDORQJDSRUWLRQRI /HPD\$YHQXH (FRQRPLF+HDOWK 1RUWKILHOGLVORFDWHGZLWKLQ ZDONLQJDQGRUELNLQJGLVWDQFH WRVRPHRIWKHODUJHVW HPSOR\PHQWKXEV $77$&+0(17